NUDT21 Recombinant Protein Antigen

Images

 
There are currently no images for NUDT21 Protein (NBP2-13682PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NUDT21 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NUDT21.

Source: E. coli

Amino Acid Sequence: DEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NUDT21
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13682.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NUDT21 Recombinant Protein Antigen

  • CFIm25
  • CFIM25CPSF 25 kDa subunit
  • cleavage and polyadenylation specific factor 5, 25 kD subunit
  • cleavage and polyadenylation specific factor 5, 25 kDa
  • Cleavage and polyadenylation specificity factor 25 kDa subunit
  • cleavage and polyadenylation specificity factor subunit 5
  • CPSF25
  • CPSF5DKFZp686H1588
  • Nucleoside diphosphate-linked moiety X motif 21
  • nudix (nucleoside diphosphate linked moiety X)-type motif 21
  • Nudix motif 21
  • pre-mRNA cleavage factor Im (25kD)
  • Pre-mRNA cleavage factor Im 25 kDa subunit
  • pre-mRNA cleavage factor Im, 25kD subunit

Background

NUDT21 is encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. This gene encodes the 25kD subunit of the protein complex, which is composed of four polypeptides.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85676
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB100-381
Species: Hu
Applications: ChIP, IP, WB
NBP1-51641
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC,  IHC-P, WB
NB100-1923
Species: Ce
Applications: IHC,  IHC-P, IP, WB
NBP2-45907
Species: Hu
Applications: IHC,  IHC-P, WB
NB500-487
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
256-GF
Species: Hu
Applications: BA
NBP1-32405
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
MAB3228
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
NBP2-48909
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KO
NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
H00001719-M01
Species: Hu, Mu, Rt, Ye
Applications: ELISA, ICC/IF, S-ELISA, WB
MAB2965
Species: Hu
Applications: CyTOF-ready, Flow
AF5110
Species: Mu
Applications: IHC, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-04411
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-20223
Species: Hu
Applications: ICC/IF, IP, WB

Publications for NUDT21 Protein (NBP2-13682PEP) (0)

There are no publications for NUDT21 Protein (NBP2-13682PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NUDT21 Protein (NBP2-13682PEP) (0)

There are no reviews for NUDT21 Protein (NBP2-13682PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NUDT21 Protein (NBP2-13682PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NUDT21 Products

Blogs on NUDT21

There are no specific blogs for NUDT21, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NUDT21 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NUDT21