NUDT2 Antibody (4A4-3C3)

Images

 
Western Blot: NUDT2 Antibody (4A4-3C3) [H00000318-M01] - Analysis of NUDT2 expression in transfected 293T cell line by NUDT2 monoclonal antibody (M01), clone 4A4-3C3.Lane 1: NUDT2 transfected lysate(16.8 KDa).Lane 2: ...read more
Western Blot: NUDT2 Antibody (4A4-3C3) [H00000318-M01] - NUDT2 monoclonal antibody (M01), clone 4A4-3C3 Analysis of NUDT2 expression in Jurkat.
ELISA: NUDT2 Antibody (4A4-3C3) [H00000318-M01] - Detection limit for recombinant GST tagged NUDT2 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC
Clone
4A4-3C3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NUDT2 Antibody (4A4-3C3) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
NUDT2 (AAH04926, 1 a.a. ~ 147 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA
Specificity
NUDT2 - nudix (nucleoside diphosphate linked moiety X)-type motif 2
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NUDT2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Publications
Read Publication using H00000318-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NUDT2 Antibody (4A4-3C3)

  • Ap4A hydrolase 1
  • Ap4A hydrolase
  • Ap4Aase
  • APAH1Diadenosine 5'-5'''-P1
  • bis(5'-nucleosyl)-tetraphosphatase (asymmetrical)
  • bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]
  • diadenosine 5'-5''-P1
  • Diadenosine tetraphosphatase
  • EC 3.6.1.17
  • MGC10404
  • Nucleoside diphosphate-linked moiety X motif 2
  • nudix (nucleoside diphosphate linked moiety X)-type motif 2
  • Nudix motif 2
  • P4-tetraphosphate asymmetrical hydrolase
  • P4-tetraphosphate pyrophosphohydrolase

Background

This gene encodes a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family. The gene product possesses a modification of the MutT sequence motif found in certain nucleotide pyrophosphatases. The enzyme asymmetrically hydrolyzes Ap4A to yield AMP and ATP and is responsible for maintaining the intracellular level of the dinucleotide Ap4A, the function of which has yet to be established. This gene may be a candidate tumor suppressor gene. Alternative splicing has been observed at this locus and three transcript variants, all encoding the same protein, have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NUDT2 Antibody (H00000318-M01)(1)

Reviews for NUDT2 Antibody (H00000318-M01) (0)

There are no reviews for NUDT2 Antibody (H00000318-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NUDT2 Antibody (H00000318-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NUDT2 Products

Research Areas for NUDT2 Antibody (H00000318-M01)

Find related products by research area.

Blogs on NUDT2

There are no specific blogs for NUDT2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NUDT2 Antibody (4A4-3C3) and receive a gift card or discount.

Bioinformatics

Gene Symbol NUDT2
Entrez
OMIM
Uniprot