NUDT16 Antibody - Azide and BSA Free

Western Blot: NUDT16 Antibody [NBP2-94422] - Analysis of extracts of various cell lines, using NUDT16 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 180s.

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

NUDT16 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit NUDT16 Antibody - Azide and BSA Free (NBP2-94422) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 60-130 of human NUDT16 (NP_689608.2). GFVDTQDRSLEDGLNRELREELGEAAAAFRVERTDYRSSHVGSGPRVVAHFYAKRLTLEELLAVEAGATRA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NUDT16
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for NUDT16 Antibody - Azide and BSA Free

• EC 3.6.1
• EC 3.6.1.-
• FLJ31265
• FLJ34034
• FLJ36248
• Nucleoside diphosphate-linked moiety X motif 16
• nudix (nucleoside diphosphate linked moiety X)-type motif 16
• Nudix motif 16
• U8 snoRNA-binding protein H29K
• U8 snoRNA-decapping enzyme

Background

RNA-decapping enzyme that binds specifically to U8 snoRNA. Part of the U8 snoRNP complex that is required forthe accumulation of mature 5.8S and 28S rRNA. Has diphosphatase activity and removes m7G and m227G caps from U8snoRNA. Has broad substrate specificity with manganese or cobalt as cofactor and can act on various RNA species (invitro)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: NUDT16