Nucleoplasmin-2 Antibody


Western Blot: Nucleoplasmin-2 Antibody [NBP1-58109] - Titration: 0.2-1 ug/ml, Positive Control: Human Placenta.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Nucleoplasmin-2 Antibody Summary

Synthetic peptides corresponding to NPM2(nucleophosmin/nucleoplasmin, 2) The peptide sequence was selected from the N terminal of NPM2 (NP_877724). Peptide sequence LEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQEDKKMQPVTIASLQA.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against NPM2 and was validated on Western blot.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Nucleoplasmin-2 Antibody

  • MGC78655
  • nucleophosmin/nucleoplasmin 2
  • nucleoplasmin-2


NPM2 belongs to the nucleoplasmin family. It probably involved in sperm DNA decondensation during fertilization.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, ICC
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB

Publications for Nucleoplasmin-2 Antibody (NBP1-58109) (0)

There are no publications for Nucleoplasmin-2 Antibody (NBP1-58109).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nucleoplasmin-2 Antibody (NBP1-58109) (0)

There are no reviews for Nucleoplasmin-2 Antibody (NBP1-58109). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nucleoplasmin-2 Antibody (NBP1-58109) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Nucleoplasmin-2 Antibody Products

Related Products by Gene

Bioinformatics Tool for Nucleoplasmin-2 Antibody (NBP1-58109)

Discover related pathways, diseases and genes to Nucleoplasmin-2 Antibody (NBP1-58109). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nucleoplasmin-2 Antibody (NBP1-58109)

Discover more about diseases related to Nucleoplasmin-2 Antibody (NBP1-58109).

Pathways for Nucleoplasmin-2 Antibody (NBP1-58109)

View related products by pathway.

PTMs for Nucleoplasmin-2 Antibody (NBP1-58109)

Learn more about PTMs related to Nucleoplasmin-2 Antibody (NBP1-58109).

Blogs on Nucleoplasmin-2

There are no specific blogs for Nucleoplasmin-2, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Nucleoplasmin-2 Antibody and receive a gift card or discount.


Gene Symbol NPM2

Customers Who Bought This Also Bought