Nucleoplasmin-2 Antibody

Images

 
Western Blot: Nucleoplasmin-2 Antibody [NBP1-58109] - Titration: 0.2-1 ug/ml, Positive Control: Human Placenta.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit

Order Details

Nucleoplasmin-2 Antibody Summary

Immunogen
Synthetic peptides corresponding to NPM2(nucleophosmin/nucleoplasmin, 2) The peptide sequence was selected from the N terminal of NPM2 (NP_877724). Peptide sequence LEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQEDKKMQPVTIASLQA.
Clonality
Polyclonal
Host
Rabbit
Gene
NPM2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against NPM2 and was validated on Western blot.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Nucleoplasmin-2 Antibody

  • MGC78655
  • nucleophosmin/nucleoplasmin 2
  • nucleoplasmin-2

Background

NPM2 belongs to the nucleoplasmin family. It probably involved in sperm DNA decondensation during fertilization.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-90999
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-76289
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, ICC
H00344018-P01
Species: Hu
NBP1-86823
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33910
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00353238-R01
Species: Hu
H00051053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-46193
Species: Hu
Applications: WB, IHC
NBP1-86103
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00136541-P01
Species: Hu
NBP2-02619
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-33518
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-26393
Species: Hu
Applications: WB, ICC/IF
NBP1-58109
Species: Hu
Applications: WB

Publications for Nucleoplasmin-2 Antibody (NBP1-58109) (0)

There are no publications for Nucleoplasmin-2 Antibody (NBP1-58109).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nucleoplasmin-2 Antibody (NBP1-58109) (0)

There are no reviews for Nucleoplasmin-2 Antibody (NBP1-58109). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nucleoplasmin-2 Antibody (NBP1-58109) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Nucleoplasmin-2 Antibody Products

Related Products by Gene

Bioinformatics Tool for Nucleoplasmin-2 Antibody (NBP1-58109)

Discover related pathways, diseases and genes to Nucleoplasmin-2 Antibody (NBP1-58109). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nucleoplasmin-2 Antibody (NBP1-58109)

Discover more about diseases related to Nucleoplasmin-2 Antibody (NBP1-58109).
 

Pathways for Nucleoplasmin-2 Antibody (NBP1-58109)

View related products by pathway.

PTMs for Nucleoplasmin-2 Antibody (NBP1-58109)

Learn more about PTMs related to Nucleoplasmin-2 Antibody (NBP1-58109).

Blogs on Nucleoplasmin-2

There are no specific blogs for Nucleoplasmin-2, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol NPM2
Entrez
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-58109 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought