NUCKS1 Antibody (3G10) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse NUCKS1 Antibody (3G10) - Azide and BSA Free (H00064710-M02) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
NUCKS1 (NP_073568.2, 1 a.a. ~ 243 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSRPVRNRKVVDYSQFQESDDADEDYGRDSGPPTKKIRSSPREAKNKRRSGKNSQEDSEDSEDKDVKTKKDDSHSAEDSEDEKEDHKNVRQQRQAASKAASKQREMLMEDVGSEEEQEEEDEAPFQEKDSGSDEDFLMEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKGKVGRPTASKASKEKTPSPKEEDEEPESPPEKKTSTSPPPEKSGDEGSEDEAPSGED |
| Specificity |
This product is specific for Human NUCKS1 monoclonal antibody (M02), clone 3G10 [Gene ID: 64710]. |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
NUCKS1 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence 10 ug/ml
- Sandwich ELISA
- Western Blot
|
| Application Notes |
Mouse monoclonal antibody raised against a full-length recombinant NUCKS1. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for NUCKS1 Antibody (3G10) - Azide and BSA Free
Background
NUCKS (nuclear ubiquitous casein and cyclin-dependent kinases substrate) is a nuclear phosphoprotein phosphorylated by Cdk1 during mitosis. It is a DNA-binding protein and bears two putative nuclear localization signals. NUCKS has been shown to localize to the cytoplasm in mitotic cells and is targeted to the nucleus during telophase. It is expressed ubiquitously and possesses features of a housekeeping gene. Alternate names for NUCKS include NUCKS1, JC7, and FLJ21480.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Ch, Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: ET
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: WB, ELISA, ICC/IF
Publications for NUCKS1 Antibody (H00064710-M02) (0)
There are no publications for NUCKS1 Antibody (H00064710-M02).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NUCKS1 Antibody (H00064710-M02) (0)
There are no reviews for NUCKS1 Antibody (H00064710-M02).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NUCKS1 Antibody (H00064710-M02). (Showing 1 - 1 of 1 FAQ).
-
If we receive a small trial aliquot of NUCKS1 antibody (3G10), cat. no H00064710-M02, we can support you with documentation (pictures) if the antibody works well. We have long experience with working on the NUCKS1 protein, including immune cytochemistry, Western immuno-blotting and immune precipitation.
- Our NUCKS1 antibody, catalog number H00064710-M02, has been validated for Western blotting and ELISA with human samples. Unfortunately we are unable to send out free samples of this product; however you may be interested in our Innovator's Reward Program. This program was designed to help scientists with the cost of their antibodies in return for valuable information. If you decide to test an antibody in a previously untested species or application we will issue you a 100% credit for the purchase price of the antibody in exchange for a review of your experiment using our product.
Secondary Antibodies
| |
Isotype Controls
|
Additional NUCKS1 Products
Blogs on NUCKS1