NTAL Antibody

Images

 
Western Blot: NTAL Antibody [NBP1-89661] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: NTAL Antibody [NBP1-89661] - Staining of human tonsil shows strong cytoplasmic positivity in reaction center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NTAL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AKRSEKIYQQRSLREDQQSFTGSRTYSLVGQAWPGPLADMAPTRKDKLLQFYPSLEDPASSRYQNFSKGSRHGSEEAYIDPIAMEYYNWGRFSKPPEDDDANSYENVLICKQKTTETGAQQEGIGGLCRGDLSLSLALKTGPT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LAT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
NTAL Protein (NBP1-89661PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NTAL Antibody

  • LAB
  • LABWilliams-Beuren syndrome chromosomal region 15 protein
  • LAT2
  • Linker for activation of B-cells
  • linker for activation of T cells family, member 2
  • linker for activation of T-cells family member 2
  • Membrane-associated adapter molecule
  • Non-T-cell activation linker
  • NTAL
  • NTALWilliams-Beuren syndrome chromosomal region 5 protein
  • WBS15
  • WBSCR15
  • WBSCR5
  • WBSCR5HSPC046
  • Williams-Beuren syndrome chromosome region 5
  • WSCR5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27104
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP2-50465
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
NBP1-46177
Species: Hu
Applications: IP (-), WB, IHC, IHC-P
NBP1-92440
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-36491
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27562
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-47989
Species: Hu
Applications: WB, IHC, IHC-P
MAB38461
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-89661
Species: Hu
Applications: WB, IHC, IHC-P

Publications for NTAL Antibody (NBP1-89661) (0)

There are no publications for NTAL Antibody (NBP1-89661).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NTAL Antibody (NBP1-89661) (0)

There are no reviews for NTAL Antibody (NBP1-89661). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NTAL Antibody (NBP1-89661) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NTAL Antibody Products

Related Products by Gene

Bioinformatics Tool for NTAL Antibody (NBP1-89661)

Discover related pathways, diseases and genes to NTAL Antibody (NBP1-89661). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NTAL Antibody (NBP1-89661)

Discover more about diseases related to NTAL Antibody (NBP1-89661).
 

Pathways for NTAL Antibody (NBP1-89661)

View related products by pathway.

PTMs for NTAL Antibody (NBP1-89661)

Learn more about PTMs related to NTAL Antibody (NBP1-89661).
 

Research Areas for NTAL Antibody (NBP1-89661)

Find related products by research area.

Blogs on NTAL

There are no specific blogs for NTAL, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NTAL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LAT2
Entrez
Uniprot

Customers Who Bought This Also Bought