nSMase Antibody

Images

 
Western Blot: nSMase Antibody [NBP1-59937] - HepG2 cell lysate, concentration 1.25ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

nSMase Antibody Summary

Immunogen
Synthetic peptides corresponding to SMPD2(sphingomyelin phosphodiesterase 2, neutral membrane (neutral sphingomyelinase)) The peptide sequence was selected from the N terminal of SMPD2. Peptide sequence RQKLSPTYPAAHHFRSGIIGSGLCVFSKHPIQELTQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SMPD2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SMPD2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for nSMase Antibody

  • EC 3.1.4.12
  • ISC1
  • lyso-PAF-PLC
  • Lyso-platelet-activating factor-phospholipase C
  • Neutral sphingomyelinase
  • NSMASE
  • N-SMase
  • NSMASE1
  • sphingomyelin phosphodiesterase 2
  • sphingomyelin phosphodiesterase 2, neutral membrane (neutral sphingomyelinase)

Background

SMPD2 converts sphingomyelin to ceramide. Hydrolyze 1-acyl-2-lyso-sn-glycero-3-phosphocholine (lyso-PC) and 1-O-alkyl-2-lyso-sn-glycero-3-phosphocholine (lyso-platelet-activating factor). The physiological substrate seems to be Lyso-PAF.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45889
Species: Hu
Applications: WB, IHC
MAB7184
Species: Hu
Applications: WB
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-84735
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-48546
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
MAB5018
Species: Hu
Applications: WB, IP
NBP1-59937
Species: Hu
Applications: WB

Publications for nSMase Antibody (NBP1-59937) (0)

There are no publications for nSMase Antibody (NBP1-59937).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for nSMase Antibody (NBP1-59937) (0)

There are no reviews for nSMase Antibody (NBP1-59937). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for nSMase Antibody (NBP1-59937) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional nSMase Products

Bioinformatics Tool for nSMase Antibody (NBP1-59937)

Discover related pathways, diseases and genes to nSMase Antibody (NBP1-59937). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for nSMase Antibody (NBP1-59937)

Discover more about diseases related to nSMase Antibody (NBP1-59937).
 

Pathways for nSMase Antibody (NBP1-59937)

View related products by pathway.

Research Areas for nSMase Antibody (NBP1-59937)

Find related products by research area.

Blogs on nSMase

There are no specific blogs for nSMase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our nSMase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SMPD2
Uniprot