NSMAF Recombinant Protein Antigen

Images

 
There are currently no images for NSMAF Protein (NBP1-84736PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NSMAF Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NSMAF.

Source: E.coli

Amino Acid Sequence: FELDVPGKVEDVVETLLQLHRASCLDKLGDQTAMITAILQSRLARTSFDKNRFQNISEKLHMECKAE

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NSMAF
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-84736.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for NSMAF Recombinant Protein Antigen

  • Factor associated with neutral sphingomyelinase activation
  • FANFactor associated with N-SMase activation
  • neutral sphingomyelinase (N-SMase) activation associated factor
  • protein FAN

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87810
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45889
Species: Hu
Applications: WB, IHC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-56533
Species: Hu
Applications: ICC/IF
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB7745
Species: Hu
Applications: WB, Simple Western, IHC
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00004354-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83227
Species: Hu, Mu(-)
Applications: WB, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF3434
Species: Hu, Mu, Rt
Applications: WB, ICC
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-87801
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84736PEP
Species: Hu
Applications: AC

Publications for NSMAF Protein (NBP1-84736PEP) (0)

There are no publications for NSMAF Protein (NBP1-84736PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NSMAF Protein (NBP1-84736PEP) (0)

There are no reviews for NSMAF Protein (NBP1-84736PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for NSMAF Protein (NBP1-84736PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for NSMAF Protein (NBP1-84736PEP)

Discover related pathways, diseases and genes to NSMAF Protein (NBP1-84736PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NSMAF Protein (NBP1-84736PEP)

Discover more about diseases related to NSMAF Protein (NBP1-84736PEP).
 

Pathways for NSMAF Protein (NBP1-84736PEP)

View related products by pathway.

PTMs for NSMAF Protein (NBP1-84736PEP)

Learn more about PTMs related to NSMAF Protein (NBP1-84736PEP).

Blogs on NSMAF

There are no specific blogs for NSMAF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NSMAF Antibody
NBP1-84735

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NSMAF Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NSMAF