Nrf2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Nrf2 Antibody [NBP2-58702] - Staining of human cell line A-431 shows localization to plasma membrane, cytosol & centrosome.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Nrf2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QKEQEKAFFAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCMQLLAQTFPFVDDNEVSSATFQSLVPDIPGHIESPVFIATNQAQSPETSVAQVAPVDLDGMQQDIEQVWEELLSIPELQCL
Specificity
Specificity of human Nrf2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NFE2L2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Nrf2 Recombinant Protein Antigen (NBP2-58702PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Nrf2 Antibody

  • HEBP1
  • NFE2L2
  • NF-E2-related factor 2
  • NFE2-related factor 2
  • NRF2 erythroid derived 2, like 2
  • Nrf2
  • nuclear factor (erythroid-derived 2)-like 2
  • nuclear factor erythroid 2-related factor 2
  • nuclear factor erythroid-derived 2-like 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-03319
Species: Hu, Mu, Rt, Mk
Applications: WB, Flow, IHC, IHC-P
NB200-209
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-16017
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00002729-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-67471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-82580
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
7270-IL/CF
Species: Hu
NB100-56583
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-75597
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC

Publications for Nrf2 Antibody (NBP2-58702) (0)

There are no publications for Nrf2 Antibody (NBP2-58702).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nrf2 Antibody (NBP2-58702) (0)

There are no reviews for Nrf2 Antibody (NBP2-58702). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Nrf2 Antibody (NBP2-58702) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Nrf2 Antibody (NBP2-58702)

Discover related pathways, diseases and genes to Nrf2 Antibody (NBP2-58702). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nrf2 Antibody (NBP2-58702)

Discover more about diseases related to Nrf2 Antibody (NBP2-58702).
 

Pathways for Nrf2 Antibody (NBP2-58702)

View related products by pathway.

PTMs for Nrf2 Antibody (NBP2-58702)

Learn more about PTMs related to Nrf2 Antibody (NBP2-58702).
 

Research Areas for Nrf2 Antibody (NBP2-58702)

Find related products by research area.

Blogs on Nrf2.

Crosstalk Between Oxidative Stress and Autophagy
By Christina Towers, PhD. Role of Reactive Species in Cellular FunctionOxidative stress is a byproduct of an imbalance between oxidants and antioxidants present in the cell resulting in dysfunctional redox signali...  Read full blog post.

PGC-1 alpha: Roles in Mitochondrial Biogenesis and Disease
An important aspect of mitochondria maintenance includes biogenesis to replenish damaged and degraded mitochondrial structures. The regulation of mitochondrial biogenesis is very complex and numerous genes regulate and synchronize protein synthesis fr...  Read full blog post.

Exploring the Many Roles of PGC-1 alpha
The peroxisome proliferator-activated receptor gamma, co-activator 1 (PGC-1 alpha or PPARGC1A) gene encodes a 91 kDa nuclear protein that acts as a transcriptional co-activator involved in energy metabolism. Interaction with PPAR gamma allows it to in...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nrf2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NFE2L2