NPBWR1 Antibody - BSA Free

Western Blot: NPBWR1 Antibody [NBP2-82292] - WB Suggested Anti-NPBWR1 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Brain

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NPBWR1 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human NPBWR1. Peptide sequence: FSEPWPANASGPDPALSCSNASTLAPLPAPLAVAVPVVYAVICAVGLAGN The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NPBWR1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 36 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NPBWR1 Antibody - BSA Free

• G protein-coupled receptor 7
• GPR7 neuropeptides B/W receptor type 1
• GPR7
• G-protein coupled receptor 7
• MGC129755
• neuropeptides B/W receptor 1
• NPBWR1
• Opioid-Somatostatin-Like Receptor 7

Background

GPR7 is a Neuropeptide Receptor GPCR. GPR7 is implicated in the regulation of feeding, neuroendorine system, memory, and learning. GPR7 has been reported in brain, mainly cerebellum and frontal cortex, and in the pituitary (O'Dowd et al., 1995). The mouse ortholog of GPR7 was shown by in situ hybridization to be expressed in discrete nuclei of brain, namely suprachiasmatic, arcuate, and ventromedial nuclei of hypothalamus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NPBWR1