![Immunohistochemistry-Paraffin: NPW Antibody [NBP2-57337] - Staining of human pituitary gland shows moderate cytoplasmic positivity in anterior pituitary gland.](http://images.novusbio.com/fullsize2/NPW-Antibody-Immunohistochemistry-Paraffin-NBP2-57337-img0003.jpg "Immunohistochemistry-Paraffin: NPW Antibody [NBP2-57337] - Staining of human pituitary gland shows moderate cytoplasmic positivity in anterior pituitary gland.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: REAPLLLPSWVQELWETRRRSSQAGIPVRAPRSPRAPEPALEPESLDFSGAGQRLRRDVSRPAVDPAANR |
| Specificity | Specificity of human NPW antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NPW |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP2-57337 | Applications | Species |
|---|---|---|
| Beumer J, Puschhof J, BauzA-Martinez J et al. High-Resolution mRNA and Secretome Atlas of Human Enteroendocrine Cells Cell May 7 2020 [PMID: 32407674] (IHC, Human) | IHC | Human |
Secondary Antibodies |
Isotype Controls |
Diseases for NPW Antibody (NBP2-57337)Discover more about diseases related to NPW Antibody (NBP2-57337).
| Pathways for NPW Antibody (NBP2-57337)View related products by pathway.
|
PTMs for NPW Antibody (NBP2-57337)Learn more about PTMs related to NPW Antibody (NBP2-57337).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NPW |
![Immunohistochemistry-Paraffin: NPBWR1 Antibody [NLS172] - Anti-NPBWR1 / GPR7 antibody IHC of human Skin, Melanoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.](http://images.novusbio.com/images2/NPBWR1-Antibody-Immunohistochemistry-Paraffin-NLS172-img0003.jpg)
![Immunohistochemistry-Paraffin: NPBWR1 Antibody [NLS172] - Analysis of anti-NPBWR1 / GPR7 antibody with human brain, pituitary.](http://images.novusbio.com/images2/NPBWR1-Antibody-Immunohistochemistry-Paraffin-NLS172-img0001.jpg)
![Immunohistochemistry-Paraffin: NPBWR1 Antibody [NLS172] - Analysis of anti-NPBWR1 / GPR7 antibody with human brain, glioblastoma.](http://images.novusbio.com/images2/NPBWR1-Antibody-Immunohistochemistry-Paraffin-NLS172-img0002.jpg)
![Immunohistochemistry-Paraffin: GPR8 Antibody [NLS6636] - Anti-NPBWR2 / GPR8 antibody IHC of human Skin, Melanoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.](http://images.novusbio.com/images2/GPR8-Antibody-Immunohistochemistry-Paraffin-NLS6636-img0004.jpg)
![Immunohistochemistry-Paraffin: GPR8 Antibody [NLS6636] - Analysis of anti-NPBWR2 / GPR8 antibody with brain, neurons and glia at 12 ug/ml.](http://images.novusbio.com/images2/GPR8-Antibody-Immunohistochemistry-Paraffin-NLS6636-img0001.jpg)
![Immunohistochemistry-Paraffin: GPR8 Antibody [NLS6636] - Analysis of anti-NPBWR2 / GPR8 antibody with human brain, glioblastoma.](http://images.novusbio.com/images2/GPR8-Antibody-Immunohistochemistry-Paraffin-NLS6636-img0002.jpg)
![Western Blot: RPL7 Antibody [NB100-2269] - Detection of human and mouse RPL7 by western blot. Samples: Whole cell lysate (50 ug) from HeLa, HEK293T, Jurkat, mouse TMCK-1, and mouse NIH 3T3 cells prepared using RIPA lysis buffer. Antibody: Affinity purified rabbit anti-RPL7 antibody NB100-2269 used for WB at 0.04 ug/ml. Detection: Chemiluminescence with an exposure time of 3 seconds.](http://images.novusbio.com/images2/RPL7-Antibody-Western-Blot-NB100-2269-img0016.jpg)
![Immunohistochemistry-Paraffin: RPL7 Antibody [NB100-2269] - Mouse renal cell carcinoma. Antibody: Affinity purified rabbit anti-RPL7 used at a dilution of 1:1,000 (0.2ug/ml). Detection: DAB](http://images.novusbio.com/images2/RPL7-Antibody-Immunohistochemistry-Paraffin-NB100-2269-img0015.jpg)
![Immunohistochemistry-Paraffin: RPL7 Antibody [NB100-2269] - Human ovarian carcinoma. Antibody: Affinity purified rabbit anti-RPL7 used at a dilution of 1:1,000 (0.2ug/ml). Detection: DAB](http://images.novusbio.com/images2/RPL7-Antibody-Immunohistochemistry-Paraffin-NB100-2269-img0014.jpg)
![Western Blot: RPL6 Antibody [NBP2-20216] - Sample (30 ug of whole cell lysate) A: A549 B: H1299 C: HCT116 D: MCF-7 12% SDS PAGE gel, diluted at 1:1000.](http://images.novusbio.com/images2/RPL6 Antibody-Western Blot-NBP2-20216-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: RPL6 Antibody [NBP2-20216] - Immunofluorescence analysis of methanol-fixed HeLa, using antibody at 1:500 dilution.](http://images.novusbio.com/images2/RPL6 Antibody-Immunocytochemistry-Immunofluorescence-NBP2-20216-img0003.jpg)
![Immunohistochemistry-Paraffin: RPL6 Antibody [NBP2-20216] - Paraffin-embedded rat fore brain. RPL6 antibody dilution: 1:500.](http://images.novusbio.com/images2/RPL6-Antibody-Immunohistochemistry-Paraffin-NBP2-20216-img0006.jpg)
![Western Blot: MED10 Antibody [NBP1-81328] - Analysis in control (vector only transfected HEK293T lysate) and MED10 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/images2/MED10-Antibody-Western-Blot-NBP1-81328-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: MED10 Antibody [NBP1-81328] - Staining of human cell line PC-3 shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/images2/MED10-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81328-img0002.jpg)
![Western Blot: TM4SF1/L6 Antibody [NBP1-76549] - Human lung tissue lysate with TM4SF1 antibody at (A) 0.5 and (B) 1 ug/mL.](http://images.novusbio.com/images2/TM4SF1-L6-Antibody-Western-Blot-NBP1-76549-img0001.jpg)
![Immunohistochemistry-Paraffin: TM4SF1/L6 Antibody [NBP1-76549] - Staining of TM4SF1 in mouse lung tissue with TM4SF1 antibody at 5 ug/mL.](http://images.novusbio.com/images2/TM4SF1-L6-Antibody-Immunohistochemistry-Paraffin-NBP1-76549-img0006.jpg)
![Immunohistochemistry-Paraffin: TM4SF1/L6 Antibody [NBP1-76549] - Mouse lung tissue with TM4SF1 antibody at 2 ug/mL.](http://images.novusbio.com/images2/TM4SF1-L6-Antibody-Immunohistochemistry-Paraffin-NBP1-76549-img0010.jpg)
![Western Blot: LASS2 Antibody (1A6) [H00029956-M01A] - Human neuroblastoma cells untreated or treated with various drugs. Image from verified customer review.](http://images.novusbio.com/images2/LASS2-Antibody-(1A6)-Western-Blot-H00029956-M01A-img0003.jpg)
![Western Blot: LASS2 Antibody (1A6) [H00029956-M01A] - S2 monoclonal antibody (M01), clone 1A6 Western Blot analysis of LASS2 expression in HepG2.](http://images.novusbio.com/images2/LASS2-Antibody-(1A6)-Western-Blot-H00029956-M01A-img0001.jpg)
![Western Blot: LASS2 Antibody (1A6) [H00029956-M01A] - S2 monoclonal antibody (M01), clone 1A6. Western Blot analysis of LASS2 expression in NIH/3T3.](http://images.novusbio.com/images2/LASS2-Antibody-(1A6)-Western-Blot-H00029956-M01A-img0002.jpg)
![Western Blot: RPL3 Antibody [NBP2-20214] - Sample (30 ug of whole cell lysate) A: JurKat B: Raji 10% SDS PAGE gel, diluted at 1:1000.](http://images.novusbio.com/images2/RPL3 Antibody-Western Blot-NBP2-20214-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: RPL3 Antibody [NBP2-20214] - Analysis of methanol-fixed A431, using antibody at 1:200 dilution.](http://images.novusbio.com/images2/RPL3 Antibody-Immunocytochemistry-Immunofluorescence-NBP2-20214-img0003.jpg)
![Immunohistochemistry-Paraffin: RPL3 Antibody [NBP2-20214] - Paraffin-embedded mouse intestine diluted at 1:500.](http://images.novusbio.com/images2/RPL3-Antibody-Immunohistochemistry-Paraffin-NBP2-20214-img0005.jpg)
![Western Blot: FAM49B Antibody [NBP1-88582] - Analysis in human cell line A-431.](http://images.novusbio.com/images2/FAM49B-Antibody-Western-Blot-NBP1-88582-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: FAM49B Antibody [NBP1-88582] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.](http://images.novusbio.com/images2/FAM49B Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88582-img0008.jpg)
![Immunohistochemistry-Paraffin: FAM49B Antibody [NBP1-88582] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells and non-germinal center cells.](http://images.novusbio.com/images2/FAM49B-Antibody-Immunohistochemistry-Paraffin-NBP1-88582-img0007.jpg)
![Western Blot: RPL10 Antibody [NBP1-84037] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/images2/RPL10-Antibody-Western-Blot-NBP1-84037-img0009.jpg)
![Immunohistochemistry-Paraffin: RPL10 Antibody [NBP1-84037] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.](http://images.novusbio.com/images2/RPL10-Antibody-Immunohistochemistry-Paraffin-NBP1-84037-img0017.jpg)
![Western Blot: RPL10 Antibody [NBP1-84037] - Analysis in human cell line HeLa.](http://images.novusbio.com/images2/RPL10-Antibody-Western-Blot-NBP1-84037-img0008.jpg)
![Western Blot: RPL5 Antibody [NBP1-31413] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with RPL5 antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.](http://images.novusbio.com/images2/RPL5-Antibody-Western-Blot-NBP1-31413-img0015.jpg)
![Immunocytochemistry/Immunofluorescence: RPL5 Antibody [NBP1-31413] - HepG2 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: RPL5 protein stained by RPL5 antibody diluted at 1:500. Blue: Hoechst 33342 staining.Scale bar = 10 um.](http://images.novusbio.com/images2/RPL5-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-31413-img0013.jpg)
![Immunohistochemistry-Paraffin: RPL5 Antibody [NBP1-31413] - Paraffin-embedded mouse hind brain. RPL5 antibody diluted at 1:500.](http://images.novusbio.com/images2/RPL5-Antibody-Immunohistochemistry-Paraffin-NBP1-31413-img0012.jpg)
![Western Blot: RPL12 Antibody [NBP1-82857] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/images2/RPL12-Antibody-Western-Blot-NBP1-82857-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: RPL12 Antibody [NBP1-82857] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus.](http://images.novusbio.com/images2/RPL12-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82857-img0005.jpg)
![Immunohistochemistry-Paraffin: RPL12 Antibody [NBP1-82857] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells and decidua cells.](http://images.novusbio.com/images2/RPL12-Antibody-Immunohistochemistry-Paraffin-NBP1-82857-img0002.jpg)
![Western Blot: RSL1D1 Antibody [H00026156-B01P] - Analysis of RSL1D1 expression in human pancreas.](http://images.novusbio.com/images2/RSL1D1-Antibody-Western-Blot-H00026156-B01P-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: RSL1D1 Antibody [H00026156-B01P] - Analysis of purified antibody to RSL1D1 on HeLa cell. (antibody concentration 10 ug/ml)](http://images.novusbio.com/images2/RSL1D1-Antibody-Immunocytochemistry-Immunofluorescence-H00026156-B01P-img0004.jpg)
![Western Blot: RSL1D1 Antibody [H00026156-B01P] - Analysis of RSL1D1 expression in A-431.](http://images.novusbio.com/images2/RSL1D1-Antibody-Western-Blot-H00026156-B01P-img0005.jpg)
![Western Blot: TMED8 Antibody [NBP1-84744] - Analysis in control (vector only transfected HEK293T lysate) and TMED8 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/images2/TMED8 Antibody-Western Blot-NBP1-84744-img0005.jpg)
![Immunohistochemistry-Paraffin: TMED8 Antibody [NBP1-84744] - Staining of human pancreas shows strong cytoplasmic positivity in islet cells.](http://images.novusbio.com/images2/TMED8-Antibody-Immunohistochemistry-Paraffin-NBP1-84744-img0002.jpg)
![Western Blot: RPL11 Antibody [NBP2-20210] - Binding to six Anopheles gambiae pupal lysis samples at 21.8 kDa, and the murine control at 20.6 kDa. Image from a verified customer review.](http://images.novusbio.com/images2/RPL11-Antibody-Western-Blot-NBP2-20210-img0004.jpg)
![Immunohistochemistry-Paraffin: RPL11 Antibody [NBP2-20210] - RPL11 antibody detects RPL11 protein at cytosol and nucleus on HeLa xenograft by immunohistochemical analysis. Sample: Paraffin-embedded HeLa xenograft. RPL11 antibody dilution: 1:500.](http://images.novusbio.com/images2/RPL11 Antibody-Immunohistochemistry-Paraffin-NBP2-20210-img0003.jpg)
![Western Blot: RPL11 Antibody [NBP2-20210] - Sample (30 ug of whole cell lysate) A: HeLa 12% SDS PAGE gel, diluted at 1:1000.](http://images.novusbio.com/images2/RPL11 Antibody-Western Blot-NBP2-20210-img0001.jpg)
![Western Blot: HN1L Antibody [NBP1-88446] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/images2/HN1L-Antibody-Western-Blot-NBP1-88446-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: HN1L Antibody [NBP1-88446] - Staining of human cell line A-431 shows localization to plasma membrane & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/images2/HN1L Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88446-img0009.jpg)
![Immunohistochemistry-Paraffin: HN1L Antibody [NBP1-88446] - Staining of human rectum shows strong cytoplasmic and nuclear positivity in glandular cells.](http://images.novusbio.com/images2/HN1L-Antibody-Immunohistochemistry-Paraffin-NBP1-88446-img0002.jpg)
![Western Blot: FAM60A Antibody [H00058516-B02P] - Analysis of FAM60A expression in transfected 293T cell line by FAM60A polyclonal antibody. Lane 1: FAM60A transfected lysate(24.31 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/images2/FAM60A Antibody-Western Blot-H00058516-B02P-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: FAM60A Antibody [H00058516-B02P] - Analysis of purified antibody to FAM60A on HeLa cell. (antibody concentration 30 ug/ml)](http://images.novusbio.com/images2/FAM60A-Antibody-Immunocytochemistry-Immunofluorescence-H00058516-B02P-img0001.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")