NPW Antibody

Images

 
Immunohistochemistry-Paraffin: NPW Antibody [NBP2-57337] - Staining of human pituitary gland shows moderate cytoplasmic positivity in anterior pituitary gland.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NPW Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: REAPLLLPSWVQELWETRRRSSQAGIPVRAPRSPRAPEPALEPESLDFSGAGQRLRRDVSRPAVDPAANR
Specificity
Specificity of human NPW antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NPW
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NPW Recombinant Protein Antigen (NBP2-57337PEP)
Publications
Read Publication using
NBP2-57337 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for NPW Antibody

  • HPPL8
  • L8
  • L8C
  • Neuropeptide W
  • PPL8
  • PPNPW
  • Prepro-Neuropeptide W
  • Preproprotein L8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-05567
Species: Hu, Mu
Applications: WB, ICC/IF
NLS172
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P
NLS6636
Species: Hu
Applications: IHC, IHC-P
NB100-2269
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, KD
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-81328
Species: Hu
Applications: WB, ICC/IF
NBP1-76549
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82857
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00026156-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-84744
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20210
Species: Hu, Mu, I
Applications: WB, IHC, IHC-P
NBP1-88446
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00058516-B02P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-57337
Species: Hu
Applications: IHC, IHC-P

Publications for NPW Antibody (NBP2-57337)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for NPW Antibody (NBP2-57337) (0)

There are no reviews for NPW Antibody (NBP2-57337). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NPW Antibody (NBP2-57337) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NPW Products

Array NBP2-57337

Bioinformatics Tool for NPW Antibody (NBP2-57337)

Discover related pathways, diseases and genes to NPW Antibody (NBP2-57337). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NPW Antibody (NBP2-57337)

Discover more about diseases related to NPW Antibody (NBP2-57337).
 

Pathways for NPW Antibody (NBP2-57337)

View related products by pathway.

PTMs for NPW Antibody (NBP2-57337)

Learn more about PTMs related to NPW Antibody (NBP2-57337).

Blogs on NPW

There are no specific blogs for NPW, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NPW Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NPW