NPAS3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NPAS3 Antibody [NBP1-88622] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: NPAS3 Antibody [NBP1-88622] - Staining of human cerebellum shows moderate cytoplasmic and nuclear positivity in Purkinje cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NPAS3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SQVELTGSSVFDYVHPGDHVEMAEQLGMKLPPGRGLLSQGTAEDGASSASSSSQSETPEPVESTSPSLLTTDNTLERSFFIRMKSTLTKRGVHIKSSGYKV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NPAS3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NPAS3 Protein (NBP1-88622PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NPAS3 Antibody

  • Basic-helix-loop-helix-PAS protein MOP6
  • BHLHE12
  • bHLHe12FLJ11605
  • Class E basic helix-loop-helix protein 12
  • Member of PAS protein 6
  • MOP6FLJ10003
  • neuronal PAS domain protein 3
  • neuronal PAS domain-containing protein 3
  • Neuronal PAS3
  • PAS domain-containing protein 6
  • PASD6FLJ11138

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3865
Species: Hu
Applications: WB, IHC
NBP2-43651
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88579
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1744
Species: Hu
Applications: IHC-P
NB120-3515
Species: Hu, Rt, Po, Bv, Ca, Fi, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, ICC
AF6108
Species: Hu
Applications: IHC
AF2608
Species: Hu
Applications: WB
NBP2-13361
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30006
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-87828
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF429
Species: Hu, Mu
Applications: WB, IHC, Block
NB110-40773
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
MAB2607
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-1081
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88622
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for NPAS3 Antibody (NBP1-88622) (0)

There are no publications for NPAS3 Antibody (NBP1-88622).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NPAS3 Antibody (NBP1-88622) (0)

There are no reviews for NPAS3 Antibody (NBP1-88622). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NPAS3 Antibody (NBP1-88622) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NPAS3 Products

Bioinformatics Tool for NPAS3 Antibody (NBP1-88622)

Discover related pathways, diseases and genes to NPAS3 Antibody (NBP1-88622). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NPAS3 Antibody (NBP1-88622)

Discover more about diseases related to NPAS3 Antibody (NBP1-88622).
 

Pathways for NPAS3 Antibody (NBP1-88622)

View related products by pathway.

Blogs on NPAS3

There are no specific blogs for NPAS3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NPAS3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NPAS3