NOV/CCN3 Antibody

Images

 
Western Blot: NOV/CCN3 Antibody [NBP1-88154] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: NOV/CCN3 Antibody [NBP1-88154] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: NOV/CCN3 Antibody [NBP1-88154] - Staining of human adrenal gland shows strong cytoplasmic positivity in zona glomerulosa.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NOV/CCN3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NOV
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NOV/CCN3 Protein (NBP1-88154PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NOV/CCN3 Antibody

  • CCN family member 3
  • CCN3
  • CCN3IGF-binding protein 9
  • IBP-9
  • IGFBP-9
  • IGFBP9novH
  • Insulin-like growth factor-binding protein 9
  • nephroblastoma overexpressed gene
  • Nephroblastoma-overexpressed gene protein homolog
  • NOV
  • NOVH
  • protein NOV homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-356
Species: Hu, Rb
Applications: WB, Simple Western, B/N, ICC/IF, IHC, IHC-P
NBP2-41266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
H00000875-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, IP, RNAi
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-53281
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC-P
AF1936
Species: Hu
Applications: WB, IP
27260002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-31330
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-88154
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NOV/CCN3 Antibody (NBP1-88154) (0)

There are no publications for NOV/CCN3 Antibody (NBP1-88154).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NOV/CCN3 Antibody (NBP1-88154) (0)

There are no reviews for NOV/CCN3 Antibody (NBP1-88154). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NOV/CCN3 Antibody (NBP1-88154). (Showing 1 - 1 of 1 FAQ).

  1. I am looking for the expression of CCN3/NOV in tumor cells and I am interested in finding an antibody that has a lot of data to support the antibody is working well. Can you make a recommendation?
    • We have two antibodies, NBP1-88154 and NBP1-88155 that have been extremely well characterized by testing at the Human Protein Atlas. Please see the Human Protein Atlas website for full testing for these products.

Secondary Antibodies

 

Isotype Controls

Additional NOV/CCN3 Products

Bioinformatics Tool for NOV/CCN3 Antibody (NBP1-88154)

Discover related pathways, diseases and genes to NOV/CCN3 Antibody (NBP1-88154). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NOV/CCN3 Antibody (NBP1-88154)

Discover more about diseases related to NOV/CCN3 Antibody (NBP1-88154).
 

Pathways for NOV/CCN3 Antibody (NBP1-88154)

View related products by pathway.

PTMs for NOV/CCN3 Antibody (NBP1-88154)

Learn more about PTMs related to NOV/CCN3 Antibody (NBP1-88154).

Blogs on NOV/CCN3

There are no specific blogs for NOV/CCN3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NOV/CCN3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NOV
Entrez