NOV/CCN3 Antibody - BSA Free

Immunohistochemistry-Paraffin: NOV/CCN3 Antibody [NBP1-88154] - Analysis in human adrenal gland and skeletal muscle tissues. Corresponding NOV RNA-seq data are presented for the same tissues.

Western Blot: NOV/CCN3 Antibody [NBP1-88154] - Analysis in control (vector only transfected HEK293T lysate) and NOV over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: NOV/CCN3 Antibody [NBP1-88154] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: NOV/CCN3 Antibody [NBP1-88154] - Staining of human adrenal gland shows moderate to strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: NOV/CCN3 Antibody [NBP1-88154] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NOV/CCN3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCN3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NOV/CCN3 Protein (NBP1-88154PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NOV/CCN3 Antibody - BSA Free

• CCN family member 3
• CCN3
• CCN3IGF-binding protein 9
• IBP-9
• IGFBP-9
• IGFBP9novH
• Insulin-like growth factor-binding protein 9
• nephroblastoma overexpressed gene
• Nephroblastoma-overexpressed gene protein homolog
• NOV
• NOVH
• protein NOV homolog

Background

CCN3 is encoded by this gene is a small secreted cysteine-rich protein and a member of the CCN family of regulatory proteins. CNN family proteins associate with the extracellular matrix and play an important role in cardiovascular and skeletal development, fibrosis and cancer development. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for NOV/CCN3 Antibody (NBP1-88154). (Showing 1 - 1 of 1 FAQ).

1. I am looking for the expression of CCN3/NOV in tumor cells and I am interested in finding an antibody that has a lot of data to support the antibody is working well. Can you make a recommendation?
   • We have two antibodies, NBP1-88154 and NBP1-88155 that have been extremely well characterized by testing at the Human Protein Atlas. Please see the Human Protein Atlas website for full testing for these products.

Bioinformatics

• Gene Symbol: CCN3