Recombinant Human NOP56 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NOP56 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-174 of Human NOL5A full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKEAMVQAEEAAAEITRKLEKQEKKRLKKEKKRLAALALASSENSSSTPEECEEMSEKPKKKKKQKPQEVPQENGMEDPSISFSKPKKKKSFSKEELMSSDLEETAGSTSIPKRKKSTPKEETVNDPEEAGHRSGSKKKRKFSKEEPVSSGPEEAVGKSSSKKKKKFHKASQED

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
NOP56
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NOP56 Protein

  • NOL5A
  • NOP56 ribonucleoprotein homolog (yeast)
  • nucleolar protein 56
  • nucleolar protein 5A (56kD with KKE/D repeat)
  • nucleolar protein 5A (56kDa with KKE/D repeat)
  • Nucleolar protein 5A

Background

Nop56p is a yeast nucleolar protein that is part of a complex with the nucleolar proteins Nop58p and fibrillarin. Nop56p is required for assembly of the 60S ribosomal subunit and is involved in pre-rRNA processing. The protein encoded by this gene is similar in sequence to Nop56p and is also found in the nucleolus. Multiple transcript variants encoding several different isoforms have been found for this gene, but the full-length nature of most of them have not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81681
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-269
Species: Hu, Mu, Rt, Ce, Ch, Dr, Pl, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
NBP1-32732
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57100
Species: Hu
Applications: ICC/IF
NBP1-82510
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2269
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-33832
Species: Hu
Applications: IHC, IHC-P
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00150094-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-40354
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP1-86909
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20245
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90063
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55754
Species: Hu
Applications: ICC/IF, IHC-P
NBP2-13656
Species: Hu
Applications: WB, IHC, IHC-P
H00010528-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for NOP56 Recombinant Protein (H00010528-P01) (0)

There are no publications for NOP56 Recombinant Protein (H00010528-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NOP56 Recombinant Protein (H00010528-P01) (0)

There are no reviews for NOP56 Recombinant Protein (H00010528-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NOP56 Recombinant Protein (H00010528-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NOP56 Products

Bioinformatics Tool for NOP56 Recombinant Protein (H00010528-P01)

Discover related pathways, diseases and genes to NOP56 Recombinant Protein (H00010528-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NOP56 Recombinant Protein (H00010528-P01)

Discover more about diseases related to NOP56 Recombinant Protein (H00010528-P01).
 

Pathways for NOP56 Recombinant Protein (H00010528-P01)

View related products by pathway.

PTMs for NOP56 Recombinant Protein (H00010528-P01)

Learn more about PTMs related to NOP56 Recombinant Protein (H00010528-P01).

Blogs on NOP56

There are no specific blogs for NOP56, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NOP56 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NOP56