NMRAL1 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the n terminal region of mouse NMRAL1. Peptide sequence: GATGAQGGSVARALLEDGTFRIRVVTRNPEQRAAKELKQQGAEVVRGDQD The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NMRAL1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for NMRAL1 Antibody - BSA Free
Background
Redox sensor protein. Undergoes restructuring and subcellular redistribution in response to changes inintracellular NADPH/NADP(+) levels. At low NADPH concentrations the protein is found mainly as a monomer, and bindsargininosuccinate synthase (ASS1), the enzyme involved in nitric oxide synthesis. Association with ASS1 impairs itsactivity and reduces the production of nitric oxide, which subsecuently prevents apoptosis. Under normal NADPHconcentrations, the protein is found as a dimer and hides the binding site for ASS1. The homodimer binds one moleculeof NADPH. Has higher affinity for NADPH than for NADP(+). Binding to NADPH is necessary to form a stable dimer
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: ELISA, IP, WB
Species: Hu
Applications: ICC
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
Publications for NMRAL1 Antibody (NBP2-87930) (0)
There are no publications for NMRAL1 Antibody (NBP2-87930).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NMRAL1 Antibody (NBP2-87930) (0)
There are no reviews for NMRAL1 Antibody (NBP2-87930).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NMRAL1 Antibody (NBP2-87930) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NMRAL1 Products
Research Areas for NMRAL1 Antibody (NBP2-87930)
Find related products by research area.
|
Blogs on NMRAL1