NMNAT-1 Antibody

Images

 
Western Blot: NMNAT-1 Antibody [NBP2-32464] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: NMNAT-1 Antibody [NBP2-32464] - Staining of human cell line U-2 OS shows localization to nucleoplasm & nuclear bodies.
Immunohistochemistry-Paraffin: NMNAT-1 Antibody [NBP2-32464] - Staining of human kidney shows strong nuclear positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NMNAT-1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NMNAT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NMNAT-1 Recombinant Protein Antigen (NBP2-32464PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NMNAT-1 Antibody

  • EC 2.7.7.1
  • EC 2.7.7.18
  • NaMN adenylyltransferase 1
  • nicotinamide mononucleotide adenylyltransferase 1
  • nicotinamide nucleotide adenylyltransferase 1
  • nicotinamide nucleotide adenylyltransferase
  • Nicotinate-nucleotide adenylyltransferase 1
  • NMN adenylyltransferase 1
  • NMNAT1
  • NMNAT-1
  • NMNATPNAT1
  • PNAT1
  • pyridine nucleotide adenylyltransferase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84943
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-27543
Species: Hu
Applications: WB, PEP-ELISA
H00023057-M02
Species: Hu
Applications: WB, ELISA
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-594
Species: Hu, Mu, Ca
Applications: WB, IHC-P
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00009354-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NB110-40591
Species: Hu
Applications: WB, IHC-P, IP
NBP1-88680
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56605
Species: Av, Bv, Sh
Applications: WB
H00065220-M01
Species: Hu, Mu
Applications: WB, ELISA
NBP2-00990
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85310
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20287
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for NMNAT-1 Antibody (NBP2-32464) (0)

There are no publications for NMNAT-1 Antibody (NBP2-32464).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NMNAT-1 Antibody (NBP2-32464) (0)

There are no reviews for NMNAT-1 Antibody (NBP2-32464). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NMNAT-1 Antibody (NBP2-32464) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NMNAT-1 Products

Bioinformatics Tool for NMNAT-1 Antibody (NBP2-32464)

Discover related pathways, diseases and genes to NMNAT-1 Antibody (NBP2-32464). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NMNAT-1 Antibody (NBP2-32464)

Discover more about diseases related to NMNAT-1 Antibody (NBP2-32464).
 

Pathways for NMNAT-1 Antibody (NBP2-32464)

View related products by pathway.

PTMs for NMNAT-1 Antibody (NBP2-32464)

Learn more about PTMs related to NMNAT-1 Antibody (NBP2-32464).
 

Research Areas for NMNAT-1 Antibody (NBP2-32464)

Find related products by research area.

Blogs on NMNAT-1

There are no specific blogs for NMNAT-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NMNAT-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NMNAT1
Entrez