NMNAT-1 Antibody


Western Blot: NMNAT-1 Antibody [NBP2-32464] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: NMNAT-1 Antibody [NBP2-32464] - Staining of human cell line U-2 OS shows localization to nucleoplasm & nuclear bodies.
Immunohistochemistry-Paraffin: NMNAT-1 Antibody [NBP2-32464] - Staining of human kidney shows strong nuclear positivity in cells in tubules.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

NMNAT-1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: LIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQD
Specificity of human NMNAT-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NMNAT-1 Recombinant Protein Antigen (NBP2-32464PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for NMNAT-1 Antibody

  • EC
  • EC
  • NaMN adenylyltransferase 1
  • nicotinamide mononucleotide adenylyltransferase 1
  • nicotinamide nucleotide adenylyltransferase 1
  • nicotinamide nucleotide adenylyltransferase
  • Nicotinate-nucleotide adenylyltransferase 1
  • NMN adenylyltransferase 1
  • NMNAT1
  • NMNAT-1
  • PNAT1
  • pyridine nucleotide adenylyltransferase 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Ce
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for NMNAT-1 Antibody (NBP2-32464) (0)

There are no publications for NMNAT-1 Antibody (NBP2-32464).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NMNAT-1 Antibody (NBP2-32464) (0)

There are no reviews for NMNAT-1 Antibody (NBP2-32464). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NMNAT-1 Antibody (NBP2-32464) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NMNAT-1 Products

Bioinformatics Tool for NMNAT-1 Antibody (NBP2-32464)

Discover related pathways, diseases and genes to NMNAT-1 Antibody (NBP2-32464). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NMNAT-1 Antibody (NBP2-32464)

Discover more about diseases related to NMNAT-1 Antibody (NBP2-32464).

Pathways for NMNAT-1 Antibody (NBP2-32464)

View related products by pathway.

PTMs for NMNAT-1 Antibody (NBP2-32464)

Learn more about PTMs related to NMNAT-1 Antibody (NBP2-32464).

Research Areas for NMNAT-1 Antibody (NBP2-32464)

Find related products by research area.

Blogs on NMNAT-1

There are no specific blogs for NMNAT-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NMNAT-1 Antibody and receive a gift card or discount.


Gene Symbol NMNAT1