NMNAT-1 Antibody - BSA Free

Western Blot: NMNAT-1 Antibody [NBP1-52973] - Reccomended Titration: 0.25 ug/ml Positive Control: HepG2 cell lysate

Western Blot: NMNAT-1 Antibody [NBP1-52973] - Sample Tissue: Human HCT116 Antibody Dilution: 1.0 ug/ml

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

NMNAT-1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to NMNAT-1 (nicotinamide nucleotide adenylyltransferase 1). The peptide sequence was selected from the N terminal of NMNAT1 (NP_073624). Peptide sequence PVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVL. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NMNAT1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 32 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Mouse reactivity reported in multiple pieces of scientific literature.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for NMNAT-1 Antibody - BSA Free

• EC 2.7.7.1
• EC 2.7.7.18
• NaMN adenylyltransferase 1
• nicotinamide mononucleotide adenylyltransferase 1
• nicotinamide nucleotide adenylyltransferase 1
• nicotinamide nucleotide adenylyltransferase
• Nicotinate-nucleotide adenylyltransferase 1
• NMN adenylyltransferase 1
• NMNAT1
• NMNAT-1
• NMNATPNAT1
• PNAT1
• pyridine nucleotide adenylyltransferase 1

Background

The coenzyme NAD and its derivatives are involved in hundreds of metabolic redox reactions and are utilized in protein ADP-ribosylation, histone deacetylation, and in some Ca(2+) signaling pathways. NMNAT (EC 2.7.7.1) is a central enzyme in NAD biosynthesis, catalyzing the condensation of nicotinamide mononucleotide (NMN) or nicotinic acid mononucleotide (NaMN) with the AMP moiety of ATP to form NAD or NaAD.The coenzyme NAD and its derivatives are involved in hundreds of metabolic redox reactions and are utilized in protein ADP-ribosylation, histone deacetylation, and in some Ca(2+) signaling pathways. NMNAT (EC 2.7.7.1) is a central enzyme in NAD biosynthesis, catalyzing the condensation of nicotinamide mononucleotide (NMN) or nicotinic acid mononucleotide (NaMN) with the AMP moiety of ATP to form NAD or NaAD (Zhang et al., 2003 [PubMed 12574164]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NMNAT-1 Antibody (NBP1-52973)(2)

Publications using NBP1-52973

• Hikosaka K, Ikutani M, Shito M et al. Deficiency of Nicotinamide Mononucleotide Adenylyltransferase 3 (Nmnat3) Causes Hemolytic Anemia by Altering the Glycolytic Flow in Mature Erythrocytes. J. Biol. Chem. 2014-04-16 [PMID: 24739386] (WB, Mouse)
• Gomes AP, Price NL, Ling AJ et al. Declining NAD+ Induces a Pseudohypoxic State Disrupting Nuclear-Mitochondrial Communication during Aging. Cell 2013-12-19 [PMID: 24360282] (WB, Mouse)

Bioinformatics

• Gene Symbol: NMNAT1
• Entrez:
  • 64802(Human)
• Uniprot:
  • Q9HAN9()