NMNAT-1 Antibody


Western Blot: NMNAT-1 Antibody [NBP1-52973] - Sample Tissue: Human HCT116 Antibody Dilution: 1.0 ug/ml
Western Blot: NMNAT-1 Antibody [NBP1-52973] - Reccomended Titration: 0.25 ug/ml Positive Control: HepG2 cell lysate

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

NMNAT-1 Antibody Summary

Synthetic peptides corresponding to NMNAT1(nicotinamide nucleotide adenylyltransferase 1) The peptide sequence was selected from the N terminal of NMNAT1 (NP_073624). Peptide sequence PVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVL.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.25 ug/ml
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Read Publications using
NBP1-52973 in the following applications:

  • WB
    2 publications

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NMNAT-1 Antibody

  • EC
  • EC
  • NaMN adenylyltransferase 1
  • nicotinamide mononucleotide adenylyltransferase 1
  • nicotinamide nucleotide adenylyltransferase 1
  • nicotinamide nucleotide adenylyltransferase
  • Nicotinate-nucleotide adenylyltransferase 1
  • NMN adenylyltransferase 1
  • NMNAT1
  • NMNAT-1
  • PNAT1
  • pyridine nucleotide adenylyltransferase 1


The coenzyme NAD and its derivatives are involved in hundreds of metabolic redox reactions and are utilized in protein ADP-ribosylation, histone deacetylation, and in some Ca(2+) signaling pathways. NMNAT (EC is a central enzyme in NAD biosynthesis, catalyzing the condensation of nicotinamide mononucleotide (NMN) or nicotinic acid mononucleotide (NaMN) with the AMP moiety of ATP to form NAD or NaAD.The coenzyme NAD and its derivatives are involved in hundreds of metabolic redox reactions and are utilized in protein ADP-ribosylation, histone deacetylation, and in some Ca(2+) signaling pathways. NMNAT (EC is a central enzyme in NAD biosynthesis, catalyzing the condensation of nicotinamide mononucleotide (NMN) or nicotinic acid mononucleotide (NaMN) with the AMP moiety of ATP to form NAD or NaAD (Zhang et al., 2003 [PubMed 12574164]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Ce
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for NMNAT-1 Antibody (NBP1-52973)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for NMNAT-1 Antibody (NBP1-52973) (0)

There are no reviews for NMNAT-1 Antibody (NBP1-52973). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NMNAT-1 Antibody (NBP1-52973) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NMNAT-1 Products

Bioinformatics Tool for NMNAT-1 Antibody (NBP1-52973)

Discover related pathways, diseases and genes to NMNAT-1 Antibody (NBP1-52973). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NMNAT-1 Antibody (NBP1-52973)

Discover more about diseases related to NMNAT-1 Antibody (NBP1-52973).

Pathways for NMNAT-1 Antibody (NBP1-52973)

View related products by pathway.

PTMs for NMNAT-1 Antibody (NBP1-52973)

Learn more about PTMs related to NMNAT-1 Antibody (NBP1-52973).

Research Areas for NMNAT-1 Antibody (NBP1-52973)

Find related products by research area.

Blogs on NMNAT-1

There are no specific blogs for NMNAT-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NMNAT-1 Antibody and receive a gift card or discount.


Gene Symbol NMNAT1