NME3 Antibody (3G10) - Azide and BSA Free

Images

 
Western Blot: NME3 Antibody (3G10) [H00004832-M13] - Analysis of NME3 expression in transfected 293T cell line by NME3 monoclonal antibody (M13), clone 3G10. Lane 1: NME3 transfected lysatE (19 KDa). Lane 2: ...read more
Sandwich ELISA: NME3 Antibody (3G10) [H00004832-M13] - Detection limit for recombinant GST tagged NME3 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3G10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

NME3 Antibody (3G10) - Azide and BSA Free Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
NME3 (NP_002504.2, 73 a.a. ~ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE
Specificity
NME3 - non-metastatic cells 3, protein expressed in (3G10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NME3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NME3 Antibody (3G10) - Azide and BSA Free

  • c371H6.2
  • DR-nm23NDPK-C
  • EC 2.7.4.6
  • KIAA0516
  • NDK 3
  • NDP kinase 3
  • NDP kinase C
  • NDPKC
  • NM23H3
  • NM23-H3
  • non-metastatic cells 3, protein expressed in
  • nucleoside diphosphate kinase 3
  • Nucleoside diphosphate kinase C

Background

Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Probably has a role in normal hematopoiesis by inhibition of granulocyte differentiation and induction of apoptosis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80992
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-02487
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00004831-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, S-ELISA, WB
AF3014
Species: Hu
Applications: Block, IHC, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
MAB305
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
NBP2-46181
Species: Hu
Applications: Flow, IHC,  IHC-P, WB
NBP1-90222
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P
NBP1-31413
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-93423
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB100-74359
Species: Ch, Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-89102
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB6896
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
H00004832-M13
Species: Hu
Applications: WB, ELISA

Publications for NME3 Antibody (H00004832-M13) (0)

There are no publications for NME3 Antibody (H00004832-M13).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NME3 Antibody (H00004832-M13) (0)

There are no reviews for NME3 Antibody (H00004832-M13). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NME3 Antibody (H00004832-M13) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NME3 Products

Array H00004832-M13

Research Areas for NME3 Antibody (H00004832-M13)

Find related products by research area.

Blogs on NME3

There are no specific blogs for NME3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NME3 Antibody (3G10) - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol NME3
Entrez
Uniprot