Recombinant Human NMDAR2C GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human NMDAR2C GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-171 of Human GRIN2C full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MGGALGPALLLTSLFGAWAGLGPGQGEQGMTVAVVFSSSGPPQAQFRARLTPQSFLDLPLEIQPLTVGVNTTNPSSLLTQICGLLGAAHVHGIVFEDNVDTEAVAQILDFISSQTHVPILSISGGSAVVLTPKVHVQTHVPSCLRPGTRLGSGVLWFWEAGIRRDGQGGGG

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
GRIN2C
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NMDAR2C GST (N-Term) Protein

  • glutamate [NMDA] receptor subunit epsilon-3
  • glutamate receptor, ionotropic, N-methyl D-aspartate 2C
  • GRIN2C
  • NMDA R, NR2C Subunit
  • NMDAR2C
  • NMDAR2CNR2C
  • N-methyl D-aspartate receptor subtype 2C
  • N-methyl-D-aspartate receptor subunit 2C
  • NR2C

Background

N-methyl-D-aspartate (NMDA) receptors are a class of ionotropic glutamate receptors. NMDA channel has been shown to be involved in long-term potentiation, an activity-dependent increase in the efficiency of synaptic transmission thought to underlie certain kinds of memory and learning. NMDA receptor channels are heteromers composed of the key receptor subunit NMDAR1 (GRIN1) and 1 or more of the 4 NMDAR2 subunits: NMDAR2A (GRIN2A), NMDAR2B (GRIN2B), NMDAR2C (GRIN2C), and NMDAR2D (GRIN2D). [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-105
Species: Hu, Mu, Rb, Rt
Applications: IHC, IHC-P, IP, WB
NB300-106
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, WB
NB300-118
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-45856
Species: Ca, Hu, Mu
Applications: ICC/IF, IF, IHC, WB
NBP2-94573
Species: Hu, Mu, Rt
Applications: WB
NBP2-67737
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB300-124
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP2-75510
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP3-16867
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
DBD00
Species: Hu
Applications: ELISA
NBP1-88191
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-02312
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-76849
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-61747
Species: Hu
Applications: ELISA, Flow, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
H00000761-M02
Species: Hu, Mu
Applications: ELISA, Func, IHC, IHC-P, S-ELISA, WB
NLS3208
Species: Bv, Eq, Hu, Pm, Po, Pm
Applications: ICC, IHC, IHC-P, WB
NBP2-61782
Species: Hu
Applications: ELISA, ICC/IF, WB

Publications for NMDAR2C Recombinant Protein (H00002905-P01) (0)

There are no publications for NMDAR2C Recombinant Protein (H00002905-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NMDAR2C Recombinant Protein (H00002905-P01) (0)

There are no reviews for NMDAR2C Recombinant Protein (H00002905-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NMDAR2C Recombinant Protein (H00002905-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NMDAR2C Products

Bioinformatics Tool for NMDAR2C Recombinant Protein (H00002905-P01)

Discover related pathways, diseases and genes to NMDAR2C Recombinant Protein (H00002905-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NMDAR2C Recombinant Protein (H00002905-P01)

Discover more about diseases related to NMDAR2C Recombinant Protein (H00002905-P01).
 

Pathways for NMDAR2C Recombinant Protein (H00002905-P01)

View related products by pathway.

Research Areas for NMDAR2C Recombinant Protein (H00002905-P01)

Find related products by research area.

Blogs on NMDAR2C

There are no specific blogs for NMDAR2C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NMDAR2B Antibody
NB300-106-100ul

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NMDAR2C GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GRIN2C