NLRP1/NALP1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NLRP1/NALP1. Source: E. coli Amino Acid Sequence: CVWDQFLGEINPQHSWMVAGPLLDIKAEPGAVEAVHLPHFVALQGGHVDTSLFQMAHFKEEGMLLEKPARVELHHIVLENPSFSPLGVLLKMIHNALRFIPVTSVVLLYHRVHPEEVTFHLYLIPSDCSIRK Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
NLRP1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57196. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
33 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for NLRP1/NALP1 Recombinant Protein Antigen
Background
NALP1 (also known as NAC/CARD7) is a member of the CATERPILLER (CLR) diverse multigene superfamily of immune regulatory proteins (Ting and Davis, 2005). CLR proteins have a variable N-terminal domain, followed by a nucleotide-binding domain (NBD) and leucine-rich repeats (LRR). The N-terminal domain consists of transactivation, CARD, Pyrin or BIR domains, or in some cases is undefined. The CLR family, also known as the NOD family, has its ancient roots in the plant kingdom and is related to the disease resistance (R) gene family that mediates plant immune responses. CLR proteins participate in both innate and adaptive immunity in mammals, some act as sensors that detect pathogen products, and several CLR genes have been linked to susceptibility to immunological diseases. It is thought that the CLR family may have a fundamental importance for the function of the mammalian innate/ancient immune system on par with the Toll-like receptor (TLR) family. NALP1, a member of NALP CLR subfamily, has an N-terminal pyrin domain (PYD), followed by an NBD, LRR, and a C-terminal CARD domain (reviewed in Tschopp. NALP1 is a component of both the inflammasome and apoptosome, suggesting that NALP1 it has important roles in both inflammation and apoptosis. This antibody recognizes NALP1; human NALP1 is a 1473 amino acid protein and migrates at approx. 166 kDa on SDS-PAGE. However, multiple splice variants encoding distinct NALP1 isoforms with varying amino acid lengths have been described and thus the molecular weight detected may vary depending on the isoform(s) expressed.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Mu
Applications: ICC, IHC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, KD, WB
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
Species: Hu
Applications: AC
Publications for NLRP1/NALP1 Recombinant Protein Antigen (NBP2-57196PEP) (0)
There are no publications for NLRP1/NALP1 Recombinant Protein Antigen (NBP2-57196PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NLRP1/NALP1 Recombinant Protein Antigen (NBP2-57196PEP) (0)
There are no reviews for NLRP1/NALP1 Recombinant Protein Antigen (NBP2-57196PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for NLRP1/NALP1 Recombinant Protein Antigen (NBP2-57196PEP) (0)