![Western Blot: NKX2.8 Antibody [NBP2-87923] - Host: Rabbit. Target Name: NKX2-8. Sample Type: Human Fetal Lung. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize/NKX2.8-Antibody-Western-Blot-NBP2-87923-img0005.jpg "Western Blot: NKX2.8 Antibody [NBP2-87923] - Host: Rabbit. Target Name: NKX2-8. Sample Type: Human Fetal Lung. Antibody Dilution: 1.0ug/ml")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Description | Novus Biologicals Rabbit NKX2.8 Antibody - BSA Free (NBP2-87923) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human NKX2.8. Peptide sequence: GTAAAQEKCGAPPAAACPLPGYPAFGPGSALGLFPAYQHLASPALVSWNW The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NKX2-8 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Simple Western alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]](https://images.novusbio.com/images2/16253.jpg)
![Knockout Validated alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]](https://images.novusbio.com/images2/alphaFetoprotein_MAB1368_Knockout_Validated_21503.jpg)
![Knockout Validated alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]](https://images.novusbio.com/images2/alphaFetoprotein_MAB1368_Knockout_Validated_22402.jpg)
![Simple Western EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Simple_Western_21454.jpg)
![Western Blot EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Western_Blot_21511.jpg)
![Immunocytochemistry EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Immunocytochemistry__Immunofluorescence_17288.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NKX2-8 |
![Western Blot: NKX2.8 Antibody [NBP2-87923] - WB Suggested Anti-NKX2-8 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Human heart](http://images.novusbio.com/fullsize/NKX2.8-Antibody-Western-Blot-NBP2-87923-img0001.jpg "Western Blot: NKX2.8 Antibody [NBP2-87923] - WB Suggested Anti-NKX2-8 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Human heart")
![Western Blot: NKX2.8 Antibody [NBP2-87923] - Host: Mouse. Target Name: NKX2-8. Sample Tissue: Mouse Heart. Antibody Dilution: 1ug/ml](http://images.novusbio.com/fullsize/NKX2.8-Antibody-Western-Blot-NBP2-87923-img0002.jpg "Western Blot: NKX2.8 Antibody [NBP2-87923] - Host: Mouse. Target Name: NKX2-8. Sample Tissue: Mouse Heart. Antibody Dilution: 1ug/ml")
![Western Blot: NKX2.8 Antibody [NBP2-87923] - Host: Rabbit. Target Name: NKX2-8. Sample Type: Human Fetal Heart. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize/NKX2.8-Antibody-Western-Blot-NBP2-87923-img0003.jpg "Western Blot: NKX2.8 Antibody [NBP2-87923] - Host: Rabbit. Target Name: NKX2-8. Sample Type: Human Fetal Heart. Antibody Dilution: 1.0ug/ml")
![Western Blot: NKX2.8 Antibody [NBP2-87923] - Host: Rabbit. Target Name: NKX2-8. Sample Type: Human Fetal Liver. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize/NKX2.8-Antibody-Western-Blot-NBP2-87923-img0004.jpg "Western Blot: NKX2.8 Antibody [NBP2-87923] - Host: Rabbit. Target Name: NKX2-8. Sample Type: Human Fetal Liver. Antibody Dilution: 1.0ug/ml")
![Western Blot: NKX2.8 Antibody [NBP2-87923] - Host: Rabbit. Target Name: NKX2-8. Sample Type: Human Adult Placenta. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize/NKX2.8-Antibody-Western-Blot-NBP2-87923-img0006.jpg "Western Blot: NKX2.8 Antibody [NBP2-87923] - Host: Rabbit. Target Name: NKX2-8. Sample Type: Human Adult Placenta. Antibody Dilution: 1.0ug/ml")
![Western Blot p27/Kip1 [p Thr157] Antibody](https://images.novusbio.com/images2/p27_AF1555_Western_Blot_5119.jpg)
![Western Blot NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-4120241239327.jpg)
![Immunocytochemistry/ Immunofluorescence NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-41202412401270.jpg)
![Immunocytochemistry/ Immunofluorescence NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-41202412403531.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
