NKX2.5 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related NKX2.5 Peptides and Proteins

Order Details


    • Catalog Number
      NBP2-57744PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

NKX2.5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NKX2.5.

Source: E. coli

Amino Acid Sequence: LNPYGYNAYPAYPGYGGAACSPGYSCTAAYPAGPSPAQPATAAANNNFVNFGVGDLNAVQSPGIPQSNSGVSTLHGIRA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NKX2-5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57744.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NKX2.5 Recombinant Protein Antigen

  • cardiac-specific homeo box
  • cardiac-specific homeobox 1
  • Cardiac-specific homeobox
  • CHNG5
  • CSX1
  • CSXFLJ97195
  • FLJ52202
  • FLJ99536
  • Homeobox protein CSX
  • Homeobox protein NK-2 homolog E
  • homeobox protein Nkx-2.5
  • NK2 transcription factor related, locus 5 (Drosophila)
  • NKX2.5
  • NKX2.5FLJ97166
  • NKX2-5
  • NKX2E
  • NKX2EFLJ97197
  • NKX4-1
  • tinman paralog

Background

Homeobox-containing genes play critical roles in regulating tissue-specific gene expression essential for tissue differentiation, as well as determining the temporal and spatial patterns of development (Shiojima et al., 1995 [PubMed 7665173]). It has been demonstrated that a Drosophila homeobox-containing gene called 'tinman' is expressed in the developing dorsal vessel and in the equivalent of the vertebrate heart. Mutations in tinman result in loss of heart formation in the embryo, suggesting that tinman is essential for Drosophila heart formation. Furthermore, abundant expression of Csx, the presumptive mouse homolog of tinman, is observed only in the heart from the time of cardiac differentiation. CSX, the human homolog of murine Csx, has a homeodomain sequence identical to that of Csx and is expressed only in the heart, again suggesting that CSX plays an important role in human heart formation.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24585
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-24585
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-89468
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
H00006910-M01
Species: Fi, Hu, Pm, Mu
Applications: ELISA, ICC/IF, KD, WB
AF3366
Species: Hu
Applications: ICC, IHC, Simple Western, WB
314-BP
Species: Hu
Applications: BA, BA
NBP2-38234
Species: Hu
Applications: IHC,  IHC-P
NBP3-13785
Species: Hu
Applications: ELISA, Flow, ICC/IF,  IHC-P, IP, PA, WB
355-BM
Species: Hu, Mu, Rt
Applications: BA
AF1837
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP1-89090
Species: Hu
Applications: IHC,  IHC-P
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
AF3876
Species: Hu, Mu
Applications: IHC, WB
NBP2-46076
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC,  IHC-P

Publications for NKX2.5 Recombinant Protein Antigen (NBP2-57744PEP) (0)

There are no publications for NKX2.5 Recombinant Protein Antigen (NBP2-57744PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NKX2.5 Recombinant Protein Antigen (NBP2-57744PEP) (0)

There are no reviews for NKX2.5 Recombinant Protein Antigen (NBP2-57744PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NKX2.5 Recombinant Protein Antigen (NBP2-57744PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NKX2.5 Products

Array NBP2-57744PEP

Blogs on NKX2.5

There are no specific blogs for NKX2.5, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NKX2.5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NKX2-5