NKX2.5 Antibody

Western Blot: NKX2.5 Antibody [NBP2-57744] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.

Immunocytochemistry/Immunofluorescence: NKX2.5 Antibody [NBP2-57744] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.

Product Discontinued

NKX2.5 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LNPYGYNAYPAYPGYGGAACSPGYSCTAAYPAGPSPAQPATAAANNNFVNFGVGDLNAVQSPGIPQSNSGVSTLHGIRA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NKX2-5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Mouse 82%, Rat 84%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NKX2.5 Antibody

• cardiac-specific homeo box
• cardiac-specific homeobox 1
• Cardiac-specific homeobox
• CHNG5
• CSX1
• CSXFLJ97195
• FLJ52202
• FLJ99536
• Homeobox protein CSX
• Homeobox protein NK-2 homolog E
• homeobox protein Nkx-2.5
• NK2 transcription factor related, locus 5 (Drosophila)
• NKX2.5
• NKX2.5FLJ97166
• NKX2-5
• NKX2E
• NKX2EFLJ97197
• NKX4-1
• tinman paralog

Background

Homeobox-containing genes play critical roles in regulating tissue-specific gene expression essential for tissue differentiation, as well as determining the temporal and spatial patterns of development (Shiojima et al., 1995 [PubMed 7665173]). It has been demonstrated that a Drosophila homeobox-containing gene called 'tinman' is expressed in the developing dorsal vessel and in the equivalent of the vertebrate heart. Mutations in tinman result in loss of heart formation in the embryo, suggesting that tinman is essential for Drosophila heart formation. Furthermore, abundant expression of Csx, the presumptive mouse homolog of tinman, is observed only in the heart from the time of cardiac differentiation. CSX, the human homolog of murine Csx, has a homeodomain sequence identical to that of Csx and is expressed only in the heart, again suggesting that CSX plays an important role in human heart formation.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NKX2-5