NKX2.5 Antibody

Images

 
Western Blot: NKX2.5 Antibody [NBP2-57744] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: NKX2.5 Antibody [NBP2-57744] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NKX2.5 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LNPYGYNAYPAYPGYGGAACSPGYSCTAAYPAGPSPAQPATAAANNNFVNFGVGDLNAVQSPGIPQSNSGVSTLHGIRA
Specificity
Specificity of human NKX2.5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NKX2-5
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NKX2.5 Recombinant Protein Antigen (NBP2-57744PEP)

Reactivity Notes

Mouse 82%, Rat 84%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for NKX2.5 Antibody

  • cardiac-specific homeo box
  • cardiac-specific homeobox 1
  • Cardiac-specific homeobox
  • CHNG5
  • CSX1
  • CSXFLJ97195
  • FLJ52202
  • FLJ99536
  • Homeobox protein CSX
  • Homeobox protein NK-2 homolog E
  • homeobox protein Nkx-2.5
  • NK2 transcription factor related, locus 5 (Drosophila)
  • NKX2.5
  • NKX2.5FLJ97166
  • NKX2-5
  • NKX2E
  • NKX2EFLJ97197
  • NKX4-1
  • tinman paralog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24585
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-24585
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-00493
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-83237
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-33063
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF1837
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-89090
Species: Hu
Applications: IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC
AF3876
Species: Hu, Mu
Applications: WB, IHC
NBP2-46076
Species: Hu
Applications: WB, IHC
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IF
NBP1-46568
Species: Mu, Rt
Applications: WB, IHC, IHC-P
MAB4028
Species: Hu, Mu
Applications: WB

Publications for NKX2.5 Antibody (NBP2-57744) (0)

There are no publications for NKX2.5 Antibody (NBP2-57744).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NKX2.5 Antibody (NBP2-57744) (0)

There are no reviews for NKX2.5 Antibody (NBP2-57744). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NKX2.5 Antibody (NBP2-57744) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NKX2.5 Products

Bioinformatics Tool for NKX2.5 Antibody (NBP2-57744)

Discover related pathways, diseases and genes to NKX2.5 Antibody (NBP2-57744). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NKX2.5 Antibody (NBP2-57744)

Discover more about diseases related to NKX2.5 Antibody (NBP2-57744).
 

Pathways for NKX2.5 Antibody (NBP2-57744)

View related products by pathway.

PTMs for NKX2.5 Antibody (NBP2-57744)

Learn more about PTMs related to NKX2.5 Antibody (NBP2-57744).

Blogs on NKX2.5

There are no specific blogs for NKX2.5, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NKX2.5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NKX2-5