NKX2.5 Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LNPYGYNAYPAYPGYGGAACSPGYSCTAAYPAGPSPAQPATAAANNNFVNFGVGDLNAVQSPGIPQSNSGVSTLHGIRA |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NKX2-5 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for NKX2.5 Antibody
Background
Homeobox-containing genes play critical roles in regulating tissue-specific gene expression essential for tissue differentiation, as well as determining the temporal and spatial patterns of development (Shiojima et al., 1995 [PubMed 7665173]). It has been demonstrated that a Drosophila homeobox-containing gene called 'tinman' is expressed in the developing dorsal vessel and in the equivalent of the vertebrate heart. Mutations in tinman result in loss of heart formation in the embryo, suggesting that tinman is essential for Drosophila heart formation. Furthermore, abundant expression of Csx, the presumptive mouse homolog of tinman, is observed only in the heart from the time of cardiac differentiation. CSX, the human homolog of murine Csx, has a homeodomain sequence identical to that of Csx and is expressed only in the heart, again suggesting that CSX plays an important role in human heart formation.[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: BA, BA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC-P, IP, PA, WB
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Hu, Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Publications for NKX2.5 Antibody (NBP2-57744) (0)
There are no publications for NKX2.5 Antibody (NBP2-57744).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NKX2.5 Antibody (NBP2-57744) (0)
There are no reviews for NKX2.5 Antibody (NBP2-57744).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NKX2.5 Antibody (NBP2-57744) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NKX2.5 Products
Blogs on NKX2.5