NKD1 Antibody

Images

 
Immunohistochemistry: NKD1 Antibody [NBP2-30988] - Staining of human smooth muscle shows moderate cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NKD1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: WARKGIEEWIGRQRCPGGVSGPRQLRLAGTIGRSTRELVGDVLRDTLSEEEEDDFRLEVALPPEKTDGLGSGDEKKMERVSEPCP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NKD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NKD1 Protein (NBP2-30988PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NKD1 Antibody

  • Dvl-binding protein
  • hNkd
  • hNkd1
  • naked cuticle homolog 1 (Drosophila)
  • naked cuticle-1
  • Naked1
  • naked-1
  • NKD
  • protein naked cuticle homolog 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13658
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-24648
Species: Hu, Mu, Rt, Pm
Applications: WB
NBL1-07321
Species: Hu
AF1620
Species: Mu
Applications: WB, IHC
AF3287
Species: Hu, Mu, Rt
Applications: WB
NBP1-31406
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
3669-WN/CF
Species: Mu
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86990
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-76526
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP2-46367
Species: Hu
Applications: WB, IHC
AF4885
Species: Mu
Applications: WB, IP
NBP1-30656
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
AF3157
Species: Hu
Applications: WB, IHC
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-24768
Species: Hu, Mu, Rt, Ch, Pm, Xp, Ze
Applications: WB, IHC-P
NBP2-30988
Species: Hu
Applications: IHC, IHC-P

Publications for NKD1 Antibody (NBP2-30988) (0)

There are no publications for NKD1 Antibody (NBP2-30988).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NKD1 Antibody (NBP2-30988) (0)

There are no reviews for NKD1 Antibody (NBP2-30988). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NKD1 Antibody (NBP2-30988) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NKD1 Products

Bioinformatics Tool for NKD1 Antibody (NBP2-30988)

Discover related pathways, diseases and genes to NKD1 Antibody (NBP2-30988). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NKD1 Antibody (NBP2-30988)

Discover more about diseases related to NKD1 Antibody (NBP2-30988).
 

Pathways for NKD1 Antibody (NBP2-30988)

View related products by pathway.

PTMs for NKD1 Antibody (NBP2-30988)

Learn more about PTMs related to NKD1 Antibody (NBP2-30988).

Blogs on NKD1

There are no specific blogs for NKD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NKD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NKD1
Uniprot