NKD1 Antibody - BSA Free

Western Blot: NKD1 Antibody [NBP1-55270] - HepG2 tissue lysate at a concentration of 1ug/ml.

Immunohistochemistry-Paraffin: NKD1 Antibody [NBP1-55270] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NKD1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the N terminal of human NKD1 (NP_149110). Peptide sequence: ELVGDVLRDTLSEEEEDDFRLEVALPPEKTDGLGSGDEKKMERVSEPCPG. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NKD1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
  • Western Blot 1.0 ug/ml
• Theoretical MW: 52 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NKD1 Antibody - BSA Free

• Dvl-binding protein
• hNkd
• hNkd1
• naked cuticle homolog 1 (Drosophila)
• naked cuticle-1
• Naked1
• naked-1
• NKD
• protein naked cuticle homolog 1

Background

In the mouse, Nkd is a Dishevelled -binding protein that functions as a negative regulator of the Wnt-beta-catenin -Tcf signaling pathway.In the mouse, Nkd is a Dishevelled (see DVL1; MIM 601365)-binding protein that functions as a negative regulator of the Wnt (see WNT1; MIM 164820)-beta-catenin (see MIM 116806)-Tcf (see MIM 602272) signaling pathway.[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NKD1 Antibody (NBP1-55270)(2)

Publications using NBP1-55270

• Ali M, Stone D, Laknaur A et al. EZH2 activates Wnt/beta-catenin signaling in human uterine fibroids which is inhibited by the natural compound Methyl Jasmonate F&S science 2023-05-12 [PMID: 37182601] (WB, Human)
• Mac M, DeVico BM, Raspanti SM, Moody CA The SETD2 Methyltransferase Supports Productive HPV31 Replication through the LEDGF/CtIP/Rad51 Pathway Journal of virology 2023-05-31 [PMID: 37154769] (WB)

Bioinformatics

• Gene Symbol: NKD1
• Entrez:
  • 85407(Human)
• Uniprot:
  • Q969G9(Human)