NKCC1/SLC12A2 Antibody - BSA Free

Western Blot: NKCC1/SLC12A2 Antibody [NBP1-59430] - Sample Tissue: Human Jurkat Antibody Dilution: 1.0 ug/ml

Western Blot: NKCC1/SLC12A2 Antibody [NBP1-59430] - Titration: 5.0ug/ml, Positive Control: DLD1 cell lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

NKCC1/SLC12A2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SLC12A2(solute carrier family 12 (sodium/potassium/chloride transporters), member 2) The peptide sequence was selected from the C terminal of SLC12A2 (NP_001037). Peptide sequence IIAFEEIIEPYRLHEDDKEQDIADKMKEDEPWRITDNELELYKTKTYRQI The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC12A2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 131 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for NKCC1/SLC12A2 Antibody - BSA Free

• Basolateral Na-K-Cl symporter
• BSC
• BSC2
• Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 1
• NKCC1
• NKCC1MGC104233
• SLC12A2
• solute carrier family 12 (sodium/potassium/chloride transporters), member 2
• solute carrier family 12 member 2

Background

By moving chloride into epithelial cells, the Na-K-Cl cotransporter SLC12A2 aids transcellular movement of chloride across both secretory and absorptive epithelia.By moving chloride into epithelial cells, the Na-K-Cl cotransporter SLC12A2 aids transcellular movement of chloride across both secretory and absorptive epithelia (Payne et al., 1995). See also SLC12A1 (MIM 600839) and SLC12A3 (MIM 600968).[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC12A2
• Entrez:
  • 6558(Human)
• Uniprot:
  • P55011()