NKAP Antibody - BSA Free

Western Blot: NKAP Antibody [NBP2-85383] - WB Suggested Anti-NKAP Antibody. Titration: 1.0 ug/ml. Positive Control: ACHN Whole Cell

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NKAP Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NKAP Antibody - BSA Free (NBP2-85383) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human NKAP. Peptide sequence: EAVRLRKENQIYSADEKRALASFNQEERRKRENKILASFREMVYRKTKGK The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NKAP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NKAP Antibody - BSA Free

• FLJ22626
• NF-kappaB activating protein
• NF-kappa-B-activating protein
• NFKB activating protein

Background

NKAP is a transcriptional repressor that associates with the NOTCH (see MIM 190198) corepressor complex and is requiredfor T-cell development (Pajerowski et al., 2009 (PubMed 19409814)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NKAP