NIR2 Antibody

Images

 
Western Blot: NIR2 Antibody [NBP1-69043] - Human Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NIR2 Antibody Summary

Immunogen
Synthetic peptides corresponding to PITPNM1 (phosphatidylinositol transfer protein, membrane-associated 1) The peptide sequence was selected from the N terminal of PITPNM1. Peptide sequence PDGGQQPNVFNLSGAERRQRIVDTIDIVRDAVAPGEYKAEEDPRLYRSA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PITPNM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PITPNM1 and was validated on Western blot.
Theoretical MW
135 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using
NBP1-69043 in the following applications:

  • WB
    2 publications

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 27434059)

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NIR2 Antibody

  • DRES9NIR-2
  • Drosophila retinal degeneration B homolog
  • FLJ44997
  • membrane-associated phosphatidylinositol transfer protein 1
  • NIR2PITPNM
  • phosphatidylinositol transfer protein, membrane-associated 1Pyk2 N-terminal domain-interacting receptor 2
  • PITPnm 1
  • Rd9
  • RDGB
  • RDGB1
  • RDGBA
  • RDGBA1
  • retinal degeneration B alpha 1

Background

PITPNM1 belongs to a family of membrane-associated phosphatidylinositol transfer domain-containing proteins that share homology with the Drosophila retinal degeneration B (rdgB) protein (Ocaka et al., 2005 [PubMed 15627748]).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80994
Species: Hu
Applications: IHC, IHC-P
NBP1-31070
Species: Hu
Applications: WB, ICC/IF
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19842
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92190
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89112
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
H00284131-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-85958
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13742
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83132
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81804
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NB100-56082
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-12154
Species: Hu
NBP1-69043
Species: Hu, Mu
Applications: WB

Publications for NIR2 Antibody (NBP1-69043)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for NIR2 Antibody (NBP1-69043) (0)

There are no reviews for NIR2 Antibody (NBP1-69043). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NIR2 Antibody (NBP1-69043) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NIR2 Products

Bioinformatics Tool for NIR2 Antibody (NBP1-69043)

Discover related pathways, diseases and genes to NIR2 Antibody (NBP1-69043). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NIR2 Antibody (NBP1-69043)

Discover more about diseases related to NIR2 Antibody (NBP1-69043).
 

Pathways for NIR2 Antibody (NBP1-69043)

View related products by pathway.

PTMs for NIR2 Antibody (NBP1-69043)

Learn more about PTMs related to NIR2 Antibody (NBP1-69043).
 

Research Areas for NIR2 Antibody (NBP1-69043)

Find related products by research area.

Blogs on NIR2

There are no specific blogs for NIR2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NIR2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PITPNM1
Uniprot