NIPBL Recombinant Protein Antigen

Images

 
There are currently no images for NIPBL Protein (NBP1-85110PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NIPBL Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NIPBL.

Source: E. coli

Amino Acid Sequence: TEEEERLWRDLIMERVTKSADACLTTINIMTSPNMPKAVYIEDVIERVIQYTKFHLQNTLYPQYDPVYRLDPHGGGLLSSKAKRAKCS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NIPBL
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85110.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NIPBL Recombinant Protein Antigen

  • CDLS1
  • delangin
  • DKFZp434L1319
  • FLJ11203
  • FLJ12597
  • FLJ13354
  • FLJ13648
  • FLJ44854
  • IDN3-B
  • IDN3CDLS
  • Nipped-B homolog (Drosophila)
  • nipped-B-like protein
  • SCC2 homolog
  • Scc2
  • sister chromatid cohesion 2 homolog

Background

NIPBL encodes the homolog of the Drosophila melanogaster Nipped-B gene product and fungal Scc2-type sister chromatid cohesion proteins. The Drosophila protein facilitates enhancer-promoter communication of remote enhancers and plays a role in developmental regulation. It is also homologous to a family of chromosomal adherins with broad roles in sister chromatid cohesion, chromosome condensation, and DNA repair. The human protein has a bipartite nuclear targeting sequence and a putative HEAT repeat. Condensins, cohesins and other complexes with chromosome-related functions also contain HEAT repeats. Mutations in this gene result in Cornelia de Lange syndrome, a disorder characterized by dysmorphic facial features, growth delay, limb reduction defects, and mental retardation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-204
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NB100-207
Species: Ce, Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP2-20053
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, WB
H00023383-P01
Species: Hu
Applications: ELISA, AP, PA, WB
MAB1934
Species: Hu
Applications: CyTOF-ready, Flow, IP, WB
NB100-87021
Species: Hu
Applications: IP, WB
MAB6734
Species: Hu
Applications: IHC
NB100-2518
Species: Hu
Applications: Flow-IC, ICC/IF, WB
DY8198-05
Species: Hu
Applications: ELISA
NBP2-45788
Species: Ce, Hu
Applications: IHC,  IHC-P, WB
NBP2-88921
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-38313
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00000699-D01P
Species: Hu, Mu
Applications: ICC/IF, PLA, WB
NB100-563
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF4928
Species: Hu
Applications: CyTOF-ready, Flow, WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB

Publications for NIPBL Protein (NBP1-85110PEP) (0)

There are no publications for NIPBL Protein (NBP1-85110PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NIPBL Protein (NBP1-85110PEP) (0)

There are no reviews for NIPBL Protein (NBP1-85110PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NIPBL Protein (NBP1-85110PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NIPBL Products

Array NBP1-85110PEP

Research Areas for NIPBL Protein (NBP1-85110PEP)

Find related products by research area.

Blogs on NIPBL

There are no specific blogs for NIPBL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NIPBL Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NIPBL