Recombinant Human MAU2 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human MAU2 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-218 of Human KIAA0892 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MDNAEAQFTTALRLTNHQELWAFIVTNLASVYIREGNRHQELYSLLERINPDHSFPVSSHCLRAAAFYVRGLFSFFQGRYNEAKRFLRETLKMSNAEDLNRLTACSLVLLGHIFYVLGNHRESNNMVVPAMQLASKIPDMSVQLWSSALLRDLNKACGNAMDAHEAAQMHQNFSQQLLQDHIEACSLPEHNLITWTDGPPPVQFQAQNGPNTSLASLL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
MAU2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
51.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MAU2 GST (N-Term) Protein

  • Cohesin loading complex subunit SCC4 homolog
  • KIAA0892MAU2 chromatid cohesion factor homolog
  • MAU2 chromatid cohesion factor homolog (C. elegans)
  • MAU-2
  • MAU2L
  • MGC75361
  • SCC4protein MAU-2
  • sister chromatid cohesion 4

Background

MAU2 is required for association of the cohesin complex with chromatin during interphase. Plays a role in sister chromatid cohesion and normal progression through prometaphase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-52168
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
DRN00B
Species: Hu
Applications: ELISA
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
236-EG
Species: Hu
Applications: BA
DMP900
Species: Hu
Applications: ELISA
NB200-323
Species: Hu, Rt
Applications: WB
NBP1-97491
Species: Bv, Ca, Ch, Gp, Ha, Hu, Pm, Mu, Po, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
NBP2-20053
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
NBP1-86951
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DTSP20
Species: Hu
Applications: ELISA
H00002707-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-24875
Species: Ca, Hu, Mu
Applications: BA, B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
H00009700-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
H00023383-P01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for MAU2 Recombinant Protein (H00023383-P01) (0)

There are no publications for MAU2 Recombinant Protein (H00023383-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAU2 Recombinant Protein (H00023383-P01) (0)

There are no reviews for MAU2 Recombinant Protein (H00023383-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAU2 Recombinant Protein (H00023383-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MAU2 Products

Diseases for MAU2 Recombinant Protein (H00023383-P01)

Discover more about diseases related to MAU2 Recombinant Protein (H00023383-P01).
 

Pathways for MAU2 Recombinant Protein (H00023383-P01)

View related products by pathway.

Blogs on MAU2

There are no specific blogs for MAU2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MAU2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MAU2