Ninjurin-1 Antibody

Western Blot: Ninjurin 1 Antibody [NBP1-59210] - Titration: 0.2-1 ug/ml, Positive Control: Human Lung.

Product Discontinued

Ninjurin-1 Antibody Summary

• Immunogen: Synthetic peptides corresponding to NINJ1(ninjurin 1) The peptide sequence was selected from the N terminal of NINJ1. Peptide sequence DSGTEEYELNGGLPPGTPGSPDASPARWGWRHGPINVNHYASKKSAAESM. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NINJ1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against NINJ1 and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Ninjurin-1 Antibody

• Nerve injury-induced protein 1
• nerve injury-induced protein-1
• NIN1
• NINJ1
• ninjurin 1
• NINJURIN
• Ninjurin1
• Ninjurin-1

Background

NINJ1 is a homophilic cell adhesion molecule that promotes axonal growth. NINJ1 may play a role in nerve regeneration and in the formation and function of other tissues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NINJ1
• Uniprot:
  • Q92982()