Nidogen-1/Entactin Antibody (1G3)

Images

 
Western Blot: Nidogen-1/Entactin Antibody (1G3) [H00004811-M01] - Analysis of NID1 expression in transfected 293T cell line by NID1 monoclonal antibody (M01), clone 1G3.Lane 1: NID1 transfected lysate(122.1 KDa).Lane 2: ...read more
Sandwich ELISA: Nidogen-1/Entactin Antibody (1G3) [H00004811-M01] - Detection limit for recombinant GST tagged NID1 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1G3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Nidogen-1/Entactin Antibody (1G3) Summary

Immunogen
NID1 (NP_002499.1 1148 a.a. - 1247 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EGLQYPFAVTSYGKNLYFTDWKMNSVVALDLAISKETDAFQPHKQTRLYGITTALSQCPQGHNYCSVNNGGCTHLCLATPGSRTCRCPDNTLGVDCIERK
Specificity
NID1 - nidogen 1 (1G3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NID1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Nidogen-1/Entactin Antibody (1G3)

  • enactin
  • Entactin
  • Entactin-1
  • NID1
  • NID-1
  • NIDentactin
  • nidogen (enactin)
  • nidogen 1
  • Nidogen1
  • Nidogen-1

Background

This gene encodes a member of the nidogen family of basement membrane glycoproteins. The protein interacts with several other components of basement membranes, and may play a role in cell interactions with the extracellular matrix. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF3385
Species: Hu
Applications: WB, IHC
NBP1-33479
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF942
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP2-20866
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
AF2119
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00004811-M01
Species: Hu
Applications: WB, ELISA

Publications for Nidogen-1/Entactin Antibody (H00004811-M01) (0)

There are no publications for Nidogen-1/Entactin Antibody (H00004811-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nidogen-1/Entactin Antibody (H00004811-M01) (0)

There are no reviews for Nidogen-1/Entactin Antibody (H00004811-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nidogen-1/Entactin Antibody (H00004811-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Nidogen-1/Entactin Products

Bioinformatics Tool for Nidogen-1/Entactin Antibody (H00004811-M01)

Discover related pathways, diseases and genes to Nidogen-1/Entactin Antibody (H00004811-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nidogen-1/Entactin Antibody (H00004811-M01)

Discover more about diseases related to Nidogen-1/Entactin Antibody (H00004811-M01).
 

Pathways for Nidogen-1/Entactin Antibody (H00004811-M01)

View related products by pathway.

PTMs for Nidogen-1/Entactin Antibody (H00004811-M01)

Learn more about PTMs related to Nidogen-1/Entactin Antibody (H00004811-M01).

Blogs on Nidogen-1/Entactin

There are no specific blogs for Nidogen-1/Entactin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nidogen-1/Entactin Antibody (1G3) and receive a gift card or discount.

Bioinformatics

Gene Symbol NID1
Entrez
Uniprot