Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody

Images

 
Western Blot: Nicotinic Acetylcholine Receptor alpha 5 Antibody [NBP1-69122] - Titration: 0.2-1 ug/ml, Positive Control: Human Spleen.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody Summary

Immunogen
Synthetic peptides corresponding to CHRNA5 (cholinergic receptor, nicotinic, alpha 5) The peptide sequence was selected from the middle region of CHRNA5. Peptide sequence PDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFD.
Specificity
This product is specific to Subunit or Isofrom: alpha-5.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHRNA5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CHRNA5 and was validated on Western blot.
Theoretical MW
53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using
NBP1-69122 in the following applications:

  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody

  • Cholinergic receptor, neuronal nicotinic, alpha polypeptide-5
  • cholinergic receptor, nicotinic, alpha 5
  • cholinergic receptor, nicotinic, alpha polypeptide 5
  • CHRNA5
  • LNCR2
  • NACHRA5
  • neuronal acetylcholine receptor subunit alpha-5
  • neuronal nicotinic acetylcholine receptor, alpha5 subunit
  • Nicotinic Acetylcholine R alpha 5
  • Nicotinic Acetylcholine Ra5

Background

Nicotinic acetylcholine receptors (nAChRs), such as CHRNA5, are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be (hetero)pentamers composed of homologous subunits.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87534
Species: Hu, Mu
Applications: IHC, IHC-P
NBP2-60788
Species: Mu, Rt
Applications: WB, ICC/IF
NBP1-28467
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NBP1-85487
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001142-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-01437
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-1798
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, GS
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-79948
Species: Hu, Rt
Applications: WB
NBP1-80090
Species: Hu
Applications: WB
AF3014
Species: Hu
Applications: WB, IHC, Block
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-01608
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC, IHC-P
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NBP2-57262
Species: Hu
Applications: ICC/IF

Publications for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (NBP1-69122)(2)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species

Reviews for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (NBP1-69122) (0)

There are no reviews for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (NBP1-69122). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (NBP1-69122). (Showing 1 - 1 of 1 FAQs).

  1. I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.
    • A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Secondary Antibodies

 

Isotype Controls

Additional Nicotinic Acetylcholine R alpha 5/CHRNA5 Products

Bioinformatics Tool for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (NBP1-69122)

Discover related pathways, diseases and genes to Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (NBP1-69122). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (NBP1-69122)

Discover more about diseases related to Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (NBP1-69122).
 

Pathways for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (NBP1-69122)

View related products by pathway.

PTMs for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (NBP1-69122)

Learn more about PTMs related to Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (NBP1-69122).

Blogs on Nicotinic Acetylcholine R alpha 5/CHRNA5

There are no specific blogs for Nicotinic Acetylcholine R alpha 5/CHRNA5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHRNA5
Entrez