Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody

Western Blot: Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody [NBP1-69122]

• Reactivity: Hu, Mu, Rt, Rb
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody Summary

• Immunogen: Synthetic peptides corresponding to CHRNA5 (cholinergic receptor, nicotinic, alpha 5) The peptide sequence was selected from the middle region of CHRNA5. Peptide sequence PDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFD. The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This product is specific to Subunit or Isoform: alpha-5.
• Predicted Species: Rat (92%), Rabbit (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CHRNA5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100 - 1:2000
• Application Notes: This is a rabbit polyclonal antibody against CHRNA5 and was validated on Western blot.
• Theoretical MW: 53 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26904947).

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody

• Cholinergic receptor, neuronal nicotinic, alpha polypeptide-5
• cholinergic receptor, nicotinic, alpha 5
• cholinergic receptor, nicotinic, alpha polypeptide 5
• CHRNA5
• LNCR2
• NACHRA5
• neuronal acetylcholine receptor subunit alpha-5
• neuronal nicotinic acetylcholine receptor, alpha5 subunit
• Nicotinic Acetylcholine R alpha 5
• Nicotinic Acetylcholine Ra5

Background

Nicotinic acetylcholine receptors (nAChRs), such as CHRNA5, are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be (hetero)pentamers composed of homologous subunits.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (NBP1-69122)(2)

Publications using NBP1-69122

• Kim CS, Choi JS, Joo SY et al. Nicotine-Induced Apoptosis in Human Renal Proximal Tubular Epithelial Cells. PLoS ONE. 2016 Mar 31 [PMID: 27028622] (WB, Human)
• Ganic E, Singh T, Luan C et al. MafA-Controlled Nicotinic Receptor Expression Is Essential for Insulin Secretion and Is Impaired in Patients with Type 2 Diabetes Cell Rep Mar 1 2016 [PMID: 26904947] (WB, Mouse)

Review for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (NBP1-69122) (1)

Average Rating: 1

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Emily Thompson WB Human 12/13/2019

Summary

• Application: Western Blot
• Sample Tested: human cortex,D54 glioma cell,U251 glioma cell line; whole cell lysate,patient derived human glioblastoma cell lines,patient-derived human glioblastoma lines,human D54 malignant glioma cell line,control human cortex
• Species: Human
• Lot: QC4360-43412

Comments

• Comments: 30ug of protein lysate loaded; 1:250; secondary 1:1000 Gt anti-Rb HRP; fempto to develop

FAQs for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (NBP1-69122). (Showing 1 - 1 of 1 FAQs).

1. I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.
   • A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Bioinformatics

• Gene Symbol: CHRNA5