Reactivity | Hu, Mu, Rt, RbSpecies Glossary |
Applications | WB |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | Synthetic peptides corresponding to CHRNA5 (cholinergic receptor, nicotinic, alpha 5) The peptide sequence was selected from the middle region of CHRNA5. Peptide sequence PDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFD. The peptide sequence for this immunogen was taken from within the described region. |
Specificity | This product is specific to Subunit or Isoform: alpha-5. |
Predicted Species | Rat (92%), Rabbit (92%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | CHRNA5 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | This is a rabbit polyclonal antibody against CHRNA5 and was validated on Western blot. |
|
Theoretical MW | 53 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
Reviewed Applications |
|
|
Publications |
|
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS, 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Purity | Immunogen affinity purified |
Images | Ratings | Applications | Species | Date | Details | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Emily Thompson |
WB | Human | 12/13/2019 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Diseases for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (NBP1-69122)Discover more about diseases related to Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (NBP1-69122).
| Pathways for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (NBP1-69122)View related products by pathway.
|
PTMs for Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (NBP1-69122)Learn more about PTMs related to Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody (NBP1-69122).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | CHRNA5 |