NHLH2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NHLH2 Antibody [NBP2-30642] - Staining of human cell line SiHa shows localization to nucleoplasm & nuclear bodies.
Immunohistochemistry: NHLH2 Antibody [NBP2-30642] - Staining of human kidney shows strong cytoplasmic and membranous positivity in tubule cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NHLH2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LSPDQAADSDHPSSAHSDPESLGGTDTKVLGSVSDLEPVEEAEGDGKGGSRAALYPHPQQLSREE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NHLH2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NHLH2 Protein (NBP2-30642PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NHLH2 Antibody

  • BHLHA34
  • bHLHa34NSCL-2
  • Class A basic helix-loop-helix protein 34
  • helix-loop-helix protein 2
  • HEN-2
  • HEN2NSCL2
  • nescient helix loop helix 2KIAA0490

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004807-T01
Species: Hu
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-06797
Species: Hu
AF2746
Species: Hu, Mu
Applications: WB, ICC
AF2567
Species: Mu
Applications: WB, IHC
NBP2-33443
Species: Hu
Applications: IHC, IHC-P
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
NBP1-32620
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-78626
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
H00055885-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-31318
Species: Mu
Applications: IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP2-13958
Species: Hu
Applications: IHC, IHC-P
NBP2-48693
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59448
Species: Hu
Applications: WB
NBP2-41103
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP2-30642
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for NHLH2 Antibody (NBP2-30642) (0)

There are no publications for NHLH2 Antibody (NBP2-30642).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NHLH2 Antibody (NBP2-30642) (0)

There are no reviews for NHLH2 Antibody (NBP2-30642). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NHLH2 Antibody (NBP2-30642) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NHLH2 Products

Bioinformatics Tool for NHLH2 Antibody (NBP2-30642)

Discover related pathways, diseases and genes to NHLH2 Antibody (NBP2-30642). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NHLH2 Antibody (NBP2-30642)

Discover more about diseases related to NHLH2 Antibody (NBP2-30642).
 

Pathways for NHLH2 Antibody (NBP2-30642)

View related products by pathway.

PTMs for NHLH2 Antibody (NBP2-30642)

Learn more about PTMs related to NHLH2 Antibody (NBP2-30642).

Blogs on NHLH2

There are no specific blogs for NHLH2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NHLH2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NHLH2
Uniprot