HENMT1 Antibody


Western Blot: HENMT1 Antibody [NBP1-88330] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: HENMT1 Antibody [NBP1-88330] - Staining of human lymph node shows strong nuclear positivity in reaction center cells and lymphoid cells outside reaction centra.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

HENMT1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MEENNLQCSSVVDGNFEEVPRETAIQFKPPLYRQRYQFVKNLVDQHEPKKVADLGCGDTSLLRLLKVNPCIELLVGV
Specificity of human HENMT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
HENMT1 Lysate (NBP2-65169)
Control Peptide
HENMT1 Protein (NBP1-88330PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for HENMT1 Antibody

  • chromosome 1 open reading frame 59
  • EC 2.1.1.n8
  • FLJ30525
  • HEN1 methyltransferase homolog 1 (Arabidopsis)
  • HEN1 methyltransferase homolog 1
  • HEN1C1orf59hypothetical protein LOC113802
  • MGC111091


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Mk
Applications: WB, IHC
Species: Hu, Mu
Applications: IHC
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IP
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
Species: Hu
Applications: WB, IHC, IHC-P

Publications for HENMT1 Antibody (NBP1-88330) (0)

There are no publications for HENMT1 Antibody (NBP1-88330).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HENMT1 Antibody (NBP1-88330) (0)

There are no reviews for HENMT1 Antibody (NBP1-88330). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HENMT1 Antibody (NBP1-88330) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional HENMT1 Products

Bioinformatics Tool for HENMT1 Antibody (NBP1-88330)

Discover related pathways, diseases and genes to HENMT1 Antibody (NBP1-88330). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on HENMT1

There are no specific blogs for HENMT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HENMT1 Antibody and receive a gift card or discount.


Gene Symbol HENMT1