HENMT1 Antibody

Images

 
Western Blot: HENMT1 Antibody [NBP1-88330] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: HENMT1 Antibody [NBP1-88330] - Staining of human lymph node shows strong nuclear positivity in reaction center cells and lymphoid cells outside reaction centra.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HENMT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MEENNLQCSSVVDGNFEEVPRETAIQFKPPLYRQRYQFVKNLVDQHEPKKVADLGCGDTSLLRLLKVNPCIELLVGV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HENMT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HENMT1 Protein (NBP1-88330PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HENMT1 Antibody

  • chromosome 1 open reading frame 59
  • EC 2.1.1.n8
  • FLJ30525
  • HEN1 methyltransferase homolog 1 (Arabidopsis)
  • HEN1 methyltransferase homolog 1
  • HEN1C1orf59hypothetical protein LOC113802
  • MGC111091

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6367
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-2817
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NBP2-45478
Species: Hu, Mu, Rt, Mk
Applications: WB, IHC
AF6548
Species: Hu, Mu
Applications: IHC
H00004807-T01
Species: Hu
NBP2-37398
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP1-06520
Species: Hu, Mu
Applications: WB, IP
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NBP1-87257
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NBP1-87127
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P
NBP2-30642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-13382
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7650
Species: Mu
Applications: WB, IHC
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
AF4937
Species: Hu
Applications: WB, IHC
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP1-88330
Species: Hu
Applications: WB, IHC, IHC-P

Publications for HENMT1 Antibody (NBP1-88330) (0)

There are no publications for HENMT1 Antibody (NBP1-88330).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HENMT1 Antibody (NBP1-88330) (0)

There are no reviews for HENMT1 Antibody (NBP1-88330). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HENMT1 Antibody (NBP1-88330) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HENMT1 Products

Bioinformatics Tool for HENMT1 Antibody (NBP1-88330)

Discover related pathways, diseases and genes to HENMT1 Antibody (NBP1-88330). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on HENMT1

There are no specific blogs for HENMT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HENMT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HENMT1