Novus Biologicals products are now on bio-techne.com

NHE6/SLC9A6 Antibody - BSA Free

Images

 
Western Blot: NHE6/SLC9A6 Antibody [NBP2-93987] - Analysis of extracts of various cell lines, using NHE6/SLC9A6 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. ...read more

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

NHE6/SLC9A6 Antibody - BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 542-701 of human SLC9A6 (NP_001036002.1). VDSDQEHLGVPENERRTTKAESAWLFRMWYNFDHNYLKPLLTHSGPPLTTTLPACCGPIARCLTSPQAYENQEQLKDDDSDLILNDGDISLTYGDSTVNTEPATSSAPRRFMGNSSEDALDRELAFGDHELVIRGTRLVLPMDDSEPPLNLLDNTRHGPA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC9A6
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for NHE6/SLC9A6 Antibody - BSA Free

  • MRSA
  • NHE6
  • NHE6isoform 6
  • SLC9A6
  • solute carrier family 9 (sodium/hydrogen exchanger), member 6
  • Solute carrier family 9 member 6

Background

SLC9A6 - solute carrier family 9 (sodium/hydrogen exchanger), isoform 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-80859
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
DY393
Species: Hu
Applications: ELISA
AF4538
Species: Hu, Mu, Rt
Applications: WB
AF5520
Species: Hu, Mu
Applications: WB
AF6270
Species: Hu
Applications: ICC
NBP2-85831
Species: Hu
Applications: IHC, IHC-P, WB
DY1707
Species: Hu
Applications: ELISA
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-02450
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB600-1151
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
H00004810-M05
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-01446
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-86928
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-92172
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for NHE6/SLC9A6 Antibody (NBP2-93987) (0)

There are no publications for NHE6/SLC9A6 Antibody (NBP2-93987).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NHE6/SLC9A6 Antibody (NBP2-93987) (0)

There are no reviews for NHE6/SLC9A6 Antibody (NBP2-93987). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NHE6/SLC9A6 Antibody (NBP2-93987) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NHE6/SLC9A6 Products

Research Areas for NHE6/SLC9A6 Antibody (NBP2-93987)

Find related products by research area.

Blogs on NHE6/SLC9A6

There are no specific blogs for NHE6/SLC9A6, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NHE6/SLC9A6 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC9A6