NHE1/SLC9A1 Antibody - BSA Free

Western Blot: NHE1 Antibody [NBP1-62408] - Titration: 0.2-1 ug/ml, Positive Control: PANC1 cell lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NHE1/SLC9A1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SLC9A1(solute carrier family 9 (sodium/hydrogen exchanger), member 1) The peptide sequence was selected form the middle region of SLC9A1. Peptide sequence RSKETSSPGTDDVFTPAPSDSPSSQRIQRCLSDPGPHPEPGEGEPFFPKG. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC9A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NHE1/SLC9A1 Antibody - BSA Free

• APNH
• APNH1
• APNHFLJ42224
• Na(+)/H(+) antiporter, amiloride-sensitive
• Na(+)/H(+) exchanger 1
• Na+/H+, amiloride sensitive)
• Na-Li countertransporter
• NHE1
• NHE-1
• NHE1Na+/H+ antiporter, amiloride-sensitive
• SLC9A1
• sodium/hydrogen exchanger 1
• solute carrier family 9 (sodium/hydrogen exchanger), isoform 1 (antiporter
• solute carrier family 9 (sodium/hydrogen exchanger), member 1 (antiporter
• solute carrier family 9 (sodium/hydrogen exchanger), member 1
• Solute carrier family 9 member 1

Background

The Na+/H+ antiporter (SLC9A1) is a ubiquitous membrane-bound enzyme involved in pH regulation of vertebrate cells. It is specifically inhibited by the diuretic drug amiloride and activated by a variety of signals including growth factors, mitogens, neuro

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC9A1
• OMIM:
  • NP_003038(Human)