NGL-3/LRRC4B/LRCH4B Antibody


Immunohistochemistry: NGL-3/LRRC4B/LRCH4B Antibody [NBP2-31736] - Staining of pancreas.
Immunohistochemistry: NGL-3/LRRC4B/LRCH4B Antibody [NBP2-31736] - Staining of liver cancer.
Immunohistochemistry: NGL-3/LRRC4B/LRCH4B Antibody [NBP2-31736] - Staining of human liver shows strong dot-like cytoplasmic positivity in hepatocytes.
Immunohistochemistry: NGL-3/LRRC4B/LRCH4B Antibody [NBP2-31736] - Staining of pancreas.
Immunohistochemistry: NGL-3/LRRC4B/LRCH4B Antibody [NBP2-31736] - Staining of liver cancer
Immunohistochemistry: NGL-3/LRRC4B/LRCH4B Antibody [NBP2-31736] - Staining of human liver shows strong dot-like cytoplasmic positivity in hepatocytes.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

NGL-3/LRRC4B/LRCH4B Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: GTEKEPPGPTTDGVWGGGRPGDAAGPASSSTTAPAPRSSRPTEKAFTVPITDVTENALKDLDD
Specificity of human NGL-3/LRRC4B/LRCH4B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NGL-3/LRRC4B/LRCH4B Protein (NBP2-31736PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for NGL-3/LRRC4B/LRCH4B Antibody

  • DKFZp761A179
  • HSM
  • Leucine Rich Repeat Containing 4B
  • Leucine-Rich Repeat-Containing Protein 4B
  • Leucine-Rich Repeats And Immunoglobulin-Like Domains 4
  • LRIG4
  • LRRC4B
  • Netrin-G3 Ligand
  • NGL3
  • NGL-3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, ICC
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC
Species: Hu, Mu, Bv, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Applications: WB, IHC
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for NGL-3/LRRC4B/LRCH4B Antibody (NBP2-31736) (0)

There are no publications for NGL-3/LRRC4B/LRCH4B Antibody (NBP2-31736).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NGL-3/LRRC4B/LRCH4B Antibody (NBP2-31736) (0)

There are no reviews for NGL-3/LRRC4B/LRCH4B Antibody (NBP2-31736). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NGL-3/LRRC4B/LRCH4B Antibody (NBP2-31736) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NGL-3/LRRC4B/LRCH4B Products

Bioinformatics Tool for NGL-3/LRRC4B/LRCH4B Antibody (NBP2-31736)

Discover related pathways, diseases and genes to NGL-3/LRRC4B/LRCH4B Antibody (NBP2-31736). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NGL-3/LRRC4B/LRCH4B Antibody (NBP2-31736)

Discover more about diseases related to NGL-3/LRRC4B/LRCH4B Antibody (NBP2-31736).

Blogs on NGL-3/LRRC4B/LRCH4B

There are no specific blogs for NGL-3/LRRC4B/LRCH4B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NGL-3/LRRC4B/LRCH4B Antibody and receive a gift card or discount.


Gene Symbol LRRC4B