NGL-3/LRRC4B/LRCH4B Antibody - BSA Free

Immunohistochemistry-Paraffin: NGL-3/LRRC4B/LRCH4B Antibody [NBP2-31736] -Staining of human adrenal gland shows strong granular cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NGL-3/LRRC4B/LRCH4B Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GTEKEPPGPTTDGVWGGGRPGDAAGPASSSTTAPAPRSSRPTEKAFTVPITDVTENALKDLDD
• Predicted Species: Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LRRC4B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NGL-3/LRRC4B/LRCH4B Protein (NBP2-31736PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NGL-3/LRRC4B/LRCH4B Antibody - BSA Free

• DKFZp761A179
• HSM
• Leucine Rich Repeat Containing 4B
• Leucine-Rich Repeat-Containing Protein 4B
• Leucine-Rich Repeats And Immunoglobulin-Like Domains 4
• LRIG4
• LRRC4B
• Netrin-G3 Ligand
• NGL3
• NGL-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LRRC4B
• Uniprot:
  • Q9NT99()