NFRKB Antibody (3G8)

Images

 
There are currently no images for NFRKB Antibody (H00004798-M03).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
3G8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NFRKB Antibody (3G8) Summary

Immunogen
NFRKB (NP_006156, 90 a.a. ~ 197 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FPEDSAEQQNELILALFSGENFRFGNPLHIAQKLFRDGHFNPEVVKYRQLCFKSQYKRYLNSQQQYFHRLLKQILASRSDLLEMARRSGPALPFRQKRPSPSRTPEER
Specificity
NFRKB (3G8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NFRKB
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NFRKB Antibody (3G8)

  • DKFZp547B2013
  • DNA-binding protein R kappa-B
  • INO80 complex subunit G
  • INO80GDNA-binding protein R kappa B
  • nuclear factor related to kappaB binding protein
  • nuclear factor related to kappa-B-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-78759
Species: Hu
Applications: IP, WB
AF7284
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-87925
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-16500
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-93687
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-30447
Species: Hu, Rt
Applications: IHC, IHC-P, IP, WB
AF1213
Species: Mu
Applications: Block, ICC, IHC, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
NB100-56508
Species: Av, Hu, Mu, Rt
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-43278
Species: Hu
Applications: Flow, IHC, IHC-P
NBP1-85281
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB110-40709
Species: Hu
Applications: IHC, IHC-P, IP, WB
AF6175
Species: Hu
Applications: ICC, WB
H00009223-M03
Species: Ca, Ha, Hu, Rt
Applications: ELISA, ICC/IF, WB
AF2018
Species: Hu, Mu, Rt
Applications: ChIP, ICC, Simple Western, WB
AF2699
Species: Hu, Mu
Applications: ChIP, ICC, Simple Western, WB
NB600-717
Species: Bv, Ca, Ch, Fe, Gp, Hu, Ma, Mu, Po, Rb, Rt, Sh
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
H00004798-M03
Species: Hu
Applications: ELISA

Publications for NFRKB Antibody (H00004798-M03) (0)

There are no publications for NFRKB Antibody (H00004798-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NFRKB Antibody (H00004798-M03) (0)

There are no reviews for NFRKB Antibody (H00004798-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NFRKB Antibody (H00004798-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NFRKB Products

Array H00004798-M03

Bioinformatics Tool for NFRKB Antibody (H00004798-M03)

Discover related pathways, diseases and genes to NFRKB Antibody (H00004798-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NFRKB Antibody (H00004798-M03)

Discover more about diseases related to NFRKB Antibody (H00004798-M03).
 

Pathways for NFRKB Antibody (H00004798-M03)

View related products by pathway.

PTMs for NFRKB Antibody (H00004798-M03)

Learn more about PTMs related to NFRKB Antibody (H00004798-M03).

Blogs on NFRKB

There are no specific blogs for NFRKB, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NFRKB Antibody (3G8) and receive a gift card or discount.

Bioinformatics

Gene Symbol NFRKB
Entrez
OMIM
Uniprot