NFIC Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: NFIC Antibody [NBP2-37935] - Staining of human cell line MCF7 shows positivity in nucleus and nucleoli.

Immunohistochemistry-Paraffin: NFIC Antibody [NBP2-37935] - Staining of human stomach, upper shows strong nuclear positivity in glandular cells.

ChIP-Exo-Seq composite graph for Anti-NFIC (NBP2-37935) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NFIC Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RTLPSTSSSGSKRHKSGSMEEDVDTSPGGDYYTSPSSPTSSSRNWTEDMEGGISSPVKKTEMDKSPFNSPS
• Predicted Species: Mouse (97%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NFIC
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NFIC Protein (NBP2-37935PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NFIC Antibody - BSA Free

• CCAAT-binding transcription factor
• CTF5
• CTFCCAAT-box-binding transcription factor
• MGC20153
• NF1-C
• NFI
• NF-I
• NF-I/C
• NFI-C
• nuclear factor 1 C-type
• Nuclear factor 1/C
• nuclear factor I/C (CCAAT-binding transcription factor)
• Nuclear factor I/C
• TGGCA-binding protein

Background

Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NFIC
• Uniprot:
  • P08651(Human)