Home » NFIA » NFIA Antibodies » NFIA Antibody

NFIA Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: NFIA Antibody [NBP1-81406] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Western Blot: NFIA Antibody [NBP1-81406] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: NFIA Antibody [NBP1-81406] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Independent Antibodies: Immunohistochemistry-Paraffin: NFIA Antibody [NBP1-81406] - Staining of human cerebral cortex, gastrointestinal, lymphoid tissues and testis using Anti-NFIA antibody (A) NBP1-81406 shows ...read more
Western Blot: NFIA Antibody [NBP1-81406] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: NFIA Antibody [NBP1-81406] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.
Immunohistochemistry-Paraffin: NFIA Antibody [NBP1-81406] - Staining of human gastrointestinal shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: NFIA Antibody [NBP1-81406] - Staining of human lymphoid tissues shows strong nuclear positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: NFIA Antibody [NBP1-81406] - Staining of human testis shows strong nuclear positivity in Leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

        

Order Details

100% Guarantee on every product

NFIA Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VKSPQCSNPGLCVQPHHIGVSVKELDLYLAYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFSVTELVRVSQTPIAAGTGPNFSLSDLESSSYYSMSPGA
Specificity
Specificity of human NFIA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NFIA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
IHC reported in scientific literature (PMID: 26021864). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Publications
Read Publication using
NBP1-81406 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26021864).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NFIA Antibody

  • CCAAT-box-binding transcription factor
  • CTF
  • DKFZp686J23256
  • FLJ39164
  • KIAA1439DKFZp434L0422
  • NF1-A
  • NF-I/A
  • NFI-A
  • NFI-L
  • nuclear factor 1 A-type
  • Nuclear factor 1/A
  • nuclear factor I/ATGGCA-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NFIC Antibody
NBP2-76954
Western Blot: NFIC Antibody [NBP2-76954] - Western blot analysis of Nfic on different cell lysate using anti-Nfic antibody at 1/500 dilution.Positive control:Lane1: A549Lane2: SiHa
Immunocytochemistry/Immunofluorescence: NFIC Antibody [NBP2-76954] - ICC staining Nfic in SiHa cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry: NFIC Antibody [NBP2-76954] - Immunohistochemical analysis of paraffin-embedded human liver tissue using anti-Nfic antibody. Counter stained with hematoxylin. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH6) for 20 mins.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
YB1 Antibody
NBP1-97572
Western Blot: YB1 Antibody [NBP1-97572] - Western blot analysis of YB1 expression in 1) HeLa and 2) NTera2 whole cell lysates using NBP1-97572.
Immunocytochemistry/Immunofluorescence: YB1 Antibody [NBP1-97572] - The YB1 antibody was tested in HeLa cells with Dylight 488 (green). Nuclei and alpha-tubulin (NB100-690) were counterstained with DAPI (blue) and Dylight 550 (red).
Immunohistochemistry: YB1 Antibody [NBP1-97572] - IHC staining of YB1 in mouse testis using DAB with hematoxylin counterstain.
(2 Publications)
Species: Hu, Mu, Rt, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, In vivo
Presenilin-1
Antibody (APS 18)
NB100-74510
Western Blot: Presenilin-1 Antibody (APS 18) [NB100-74510] - Analysis of THP-1 cell lysate.
Immunocytochemistry/Immunofluorescence: Presenilin-1 Antibody (APS 18) [NB100-74510] - Analysis of Presenilin 1 using Presenilin 1 Monoclonal antibody (APS 18) shows staining in A2058 melanoma cells. Presenilin 1 staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Presenilin 1 at a dilution of 1:20-1:100 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunohistochemistry-Paraffin: Presenilin-1 Antibody (APS 18) [NB100-74510] - Normal biopsies of deparaffinized Human liver tissue.
(4 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
beta Amyloid
Antibody (MOAB-2)
NBP2-13075
Immunohistochemistry: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - IHC analysis of beta Amyloid on normal mouse brain (left) and 5xFAD mouse brain (right) using DAB with hematoxylin counterstain. The MOAB-2 antibody was used at 1:20 on normal mouse brain and at 1:400 on 5xFAD mouse brain.
Immunocytochemistry/Immunofluorescence: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Immunofluorescent detection of beta Amyloid with MOAB-2 in the subiculim of 1-, 2- and 4- month old 5xFAD mice. Scale bar 20 um (from PMID: 22423893).
Western Blot: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Analysis of beta Amyloid (MOAB-2) antibody in (1) 100 pmole beta Amyloid 42, (2) 5xFAD mouse brain homogenate Repetition 1 and (3) 5xFAD mouse brain homogenate Repetition 2.
(2 Reviews)
(24 Publications)
Species: Hu, Mu, Rt, Mk
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
SP1 Antibody
NB600-233
Western Blot: SP1 Antibody [NB600-233] - Samples: Whole cell lysate (50 ug) from HeLa, 293T, and mouse Renca cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-SP1 antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
Immunohistochemistry-Paraffin: SP1 Antibody [NB600-233] - Mouse renal cell carcinoma. Antibody: Affinity purified rabbit anti-SP1 used at a dilution of 1:5,000 (0.2ug/ml). Detection: DAB
Chromatin Immunoprecipitation: SP1 Antibody [NB600-233] - Chromatin from acute myeloid leukemia cell line was immunoprecipitated with anti-Sp1 antibody and analyzed by DNA sequencing. The figure illustrates the peak distribution of Sp1 binding within a 250 Kb region of chromosome 6 asdetected using anti-Sp1.
(4 Publications)
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
Neurofibromin 1
Antibody
NB300-155
Western Blot: Neurofibromin 1 Antibody [NB300-155] - Western Blot of (A, B, C above).
Immunohistochemistry: Neurofibromin 1 Antibody [NB300-155] - NF1 protein labeling displays positive signal in the maturing and the hypertrophic cartilages but only faint labeling in the proliferative cartilage.
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
COCO/DAND5
Antibody (OTI2H3)
NBP2-01223
Western Blot: DAND5 Antibody (2H3) [NBP2-01223] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY DAND5 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-DAND5.
Immunohistochemistry-Paraffin: DAND5 Antibody (2H3) [NBP2-01223] Staining of paraffin-embedded Carcinoma of Human bladder tissue using anti-DAND5 mouse monoclonal antibody.
Flow Cytometry: DAND5 Antibody (2H3) [NBP2-01223] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-DAND5 antibody, and then analyzed by flow cytometry.
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Presenilin-2
Antibody (APS 21)
NB100-74512
Western Blot: Presenilin-2 Antibody (APS 21) [NB100-74512] - Analysis of 25 ug of SH-SY5Y (lane 1), human brain (lane 2) and PC12 (lane 3).
Immunocytochemistry/Immunofluorescence: Presenilin-2 Antibody (APS 21) [NB100-74512] - Presenilin- 2 staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Presenilin 2 at a dilution of 1:100 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunohistochemistry-Paraffin: Presenilin-2 Antibody (APS 21) [NB100-74512] - Normal biopsies of deparaffinized Human kidney tissue.
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NFIB Antibody
NBP1-81000
Western Blot: NFIB Antibody [NBP1-81000] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: NFIB Antibody [NBP1-81000] - Staining of human cell line U-251 MG shows localization to nucleoplasm & nucleoli fibrillar center. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NFIB Antibody [NBP1-81000] - Staining of human skin shows moderate nuclear positivity in squamous epithelial cells.
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
c-jun Antibody
(5B1)
NBP2-37576
Western Blot: c-jun Antibody (5B1) [NBP2-37576] - Analysis using c-Jun mouse mAb against NIH/3T3 (1) and Cos7 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: c-jun Antibody (5B1) [NBP2-37576] - Analysis of PC-2 cells using c-Jun mouse mAb (green). Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: c-jun Antibody (5B1) [NBP2-37576] - Analysis of human rectum cancer tissues using c-Jun mouse mAb with DAB staining.
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated: c-Fos Antibody (2H2) [NBP2-50037] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and c-Fox knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Mouse Anti-Human c-Fox Monoclonal Antibody (Catalog # NBP2-50037) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for c-Fox at approximately 52 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: c-Fos Antibody (2H2) [NBP2-50037] - Analysis of cell lysates using mouse c-Fos mAb, dilution 1:1,000 (Green), and rabbit GAPDH pAb, dilution 1:20,000 (Red) used as a loading control. [1] protein standard (red), [2] HeLa cells in serum free media. [3] HeLa cells stimulated with 20% fetal bovine serum for 2hrs after 36hrs in serum free media. [4] rat cortical neurons. [5] rat cortical neurons treated with membrane depolarization buffer for 5hrs. Multiple bands at 50-65kDa in stimulated or treated cell lysates correspond to different forms of the c-Fos proten. The single band at 37 kDa represents GAPDH protein.
Immunocytochemistry/Immunofluorescence: c-Fos Antibody (2H2) [NBP2-50037] - Section of rat hippocampus stained with mouse monoclonal antibody to c-FOS NBP2-50037 in red and counterstained with rabbit polyclonal antibody to FOX3/NeuN. DAPI reveals nuclei of neurons and glia in blue. The hippocampal neurons stain green for FOX3/NeuN and a few also are expressing c-FOS, and so appear orange. These cells were spontaneously active at the time the animal was sacrificed.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
BACE-1 Antibody
(137612)
MAB931
Western blot shows lysates of human brain (Alzheimer's disease hippocampus) tissue. PVDF Membrane was probed with 2 µg/mL of Mouse Anti-Human/Mouse BACE‑1 Ectodomain Monoclonal Antibody (Catalog # MAB931) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). Specific bands were detected for BACE‑1 at approximately 60 and 70 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(5 Publications)
Species: Hu, Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
DNASE1 Antibody
NBP1-84999
Western Blot: DNASE1 Antibody [NBP1-84999] - Analysis in control (vector only transfected HEK293T lysate) and DNASE1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: DNASE1 Antibody [NBP1-84999] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: DNASE1 Antibody [NBP1-84999] - Analysis in human duodenum and liver tissues using Anti-DNASE1 antibody. Corresponding DNASE1 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
FosB/G0S3 Antibody
(83B1138)
NB100-56530
Western Blot: FosB/G0S3 Antibody (83B1138) [NB100-56530] - Analysis of FosB in HeLa cell lysate where bands are observed at ~38 kDa representing FosB and at ~35 kDa representing delta FosB.
Species: Hu
Applications: WB
NFIX Antibody
NBP2-15039
Western Blot: NFIX Antibody [NBP2-15039] - Various tissue extracts (50 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with NFIX antibody [N3C3] diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Paraffin: NFIX Antibody [NBP2-15039] - Mouse hippocampus. NFIX stained by NFIX antibody [N3C3] diluted at 1:500.
Western Blot: NFIX Antibody [NBP2-15039] - Sample (30 ug of whole cell lysate) A: U87-MG 10% SDS PAGE diluted at 1:1000 The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301 was used to detect the primary antibody.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, ChIP
JunD [p Ser255]
Antibody (JJ08-21)
NBP2-67861
Immunocytochemistry/Immunofluorescence: JunD [p Ser255] Antibody (JJ08-21) [NBP2-67861] - Staining Phospho-JunD(S255) in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: JunD [p Ser255] Antibody (JJ08-21) [NBP2-67861] - Analysis of paraffin-embedded mouse liver tissue using anti-Phospho-JunD(S255) antibody. Counter stained with hematoxylin.
Immunocytochemistry/Immunofluorescence: JunD [p Ser255] Antibody (JJ08-21) [NBP2-67861] - Staining Phospho-JunD(S255) in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NFIA Antibody (NBP1-81406)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for NFIA Antibody (NBP1-81406) (0)

There are no reviews for NFIA Antibody (NBP1-81406). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NFIA Antibody (NBP1-81406) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional NFIA Products

Bioinformatics Tool for NFIA Antibody (NBP1-81406)

Discover related pathways, diseases and genes to NFIA Antibody (NBP1-81406). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NFIA Antibody (NBP1-81406)

Discover more about diseases related to NFIA Antibody (NBP1-81406).
 

Pathways for NFIA Antibody (NBP1-81406)

View related products by pathway.

PTMs for NFIA Antibody (NBP1-81406)

Learn more about PTMs related to NFIA Antibody (NBP1-81406).

Blogs on NFIA

There are no specific blogs for NFIA, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NFIA Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol NFIA
COVID-19 update