NFIA Antibody

Images

 
Independent Antibodies: Immunohistochemistry-Paraffin: NFIA Antibody [NBP1-81406] - Staining of human cerebral cortex, gastrointestinal, lymphoid tissues and testis using Anti-NFIA antibody (A) NBP1-81406 shows ...read more
Orthogonal Strategies: Western Blot: NFIA Antibody [NBP1-81406] - Analysis in human cell line HeLa and human cell line CACO-2.
Western Blot: NFIA Antibody [NBP1-81406] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: NFIA Antibody [NBP1-81406] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NFIA Antibody [NBP1-81406] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.
Immunohistochemistry-Paraffin: NFIA Antibody [NBP1-81406] - Staining of human gastrointestinal shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: NFIA Antibody [NBP1-81406] - Staining of human lymphoid tissues shows strong nuclear positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: NFIA Antibody [NBP1-81406] - Staining of human testis shows strong nuclear positivity in Leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NFIA Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VKSPQCSNPGLCVQPHHIGVSVKELDLYLAYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFSVTELVRVSQTPIAAGTGPNFSLSDLESSSYYSMSPGA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NFIA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
IHC reported in scientific literature (PMID: 26021864). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NFIA Protein (NBP1-81406PEP)
Publications
Read Publications using
NBP1-81406 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26021864).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NFIA Antibody

  • CCAAT-box-binding transcription factor
  • CTF
  • DKFZp686J23256
  • FLJ39164
  • KIAA1439DKFZp434L0422
  • NF1-A
  • NF-I/A
  • NFI-A
  • NFI-L
  • nuclear factor 1 A-type
  • Nuclear factor 1/A
  • nuclear factor I/ATGGCA-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004782-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NBP1-97572
Species: Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, IP, In vivo, KD, Simple Western, WB
NB100-74510
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
NB300-155
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-01223
Species: Hu
Applications: Flow, IHC, IHC-P, WB
DPSG10
Species: Hu
Applications: ELISA
NB100-74513
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-81000
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
MAB931
Species: Hu, Mu
Applications: CyTOF-ready, IHC, ICFlow, WB
NBP1-84999
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-67710
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-15039
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
NBP2-67861
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81406
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NFIA Antibody (NBP1-81406)(2)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 2 applications: ICC/IF, IHC.


Filter By Application
ICC/IF
(1)
IHC
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species

Reviews for NFIA Antibody (NBP1-81406) (0)

There are no reviews for NFIA Antibody (NBP1-81406). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NFIA Antibody (NBP1-81406) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NFIA Products

Bioinformatics Tool for NFIA Antibody (NBP1-81406)

Discover related pathways, diseases and genes to NFIA Antibody (NBP1-81406). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NFIA Antibody (NBP1-81406)

Discover more about diseases related to NFIA Antibody (NBP1-81406).
 

Pathways for NFIA Antibody (NBP1-81406)

View related products by pathway.

PTMs for NFIA Antibody (NBP1-81406)

Learn more about PTMs related to NFIA Antibody (NBP1-81406).
 

Research Areas for NFIA Antibody (NBP1-81406)

Find related products by research area.

Blogs on NFIA

There are no specific blogs for NFIA, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NFIA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NFIA