Recombinant Human NFATC3/NFAT4 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human NFATC3/NFAT4 Protein [H00004775-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human NFATC3/NFAT4 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 70-149 of Human NFATC3/NFAT4

Source: Wheat Germ (in vitro)

Amino Acid Sequence: HSSVLSPSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNCHQELDAHEDDLQINDPEREFLERPSRDHL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
NFATC3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
34.54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NFATC3/NFAT4 GST (N-Term) Protein

  • NFAT4
  • NF-AT4
  • NFAT4nuclear factor of activated T-cells, cytoplasmic 3
  • NFATC3
  • NF-ATc3
  • NFATX
  • nuclear factor of activated T-cells c3 isoform IE-Xa
  • nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3
  • T cell transcription factor NFAT4
  • T-cell transcription factor NFAT4

Background

NFATC3 - nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-504
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, S-ELISA, WB
NB100-56732
Species: Hu, Mu
Applications: ICC/IF, IHC, Simple Western, WB
NBP1-46210
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
202-IL
Species: Hu
Applications: BA
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
6507-IL/CF
Species: Hu
Applications: BA
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
210-TA
Species: Hu
Applications: BA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-91745
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
355-BM/CF
Species: Hu, Mu, Rt
Applications: BA
QET00B
Species: Hu
Applications: ELISA
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
NBP2-88869
Species: Hu
Applications: IHC, IHC-P, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
H00004775-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for NFATC3/NFAT4 Partial Recombinant Protein (H00004775-Q01) (0)

There are no publications for NFATC3/NFAT4 Partial Recombinant Protein (H00004775-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NFATC3/NFAT4 Partial Recombinant Protein (H00004775-Q01) (0)

There are no reviews for NFATC3/NFAT4 Partial Recombinant Protein (H00004775-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NFATC3/NFAT4 Partial Recombinant Protein (H00004775-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NFATC3/NFAT4 Products

Bioinformatics Tool for NFATC3/NFAT4 Partial Recombinant Protein (H00004775-Q01)

Discover related pathways, diseases and genes to NFATC3/NFAT4 Partial Recombinant Protein (H00004775-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NFATC3/NFAT4 Partial Recombinant Protein (H00004775-Q01)

Discover more about diseases related to NFATC3/NFAT4 Partial Recombinant Protein (H00004775-Q01).
 

Pathways for NFATC3/NFAT4 Partial Recombinant Protein (H00004775-Q01)

View related products by pathway.

PTMs for NFATC3/NFAT4 Partial Recombinant Protein (H00004775-Q01)

Learn more about PTMs related to NFATC3/NFAT4 Partial Recombinant Protein (H00004775-Q01).
 

Research Areas for NFATC3/NFAT4 Partial Recombinant Protein (H00004775-Q01)

Find related products by research area.

Blogs on NFATC3/NFAT4

There are no specific blogs for NFATC3/NFAT4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NFATC3/NFAT4 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NFATC3