Neuronal Pentraxin 1 Antibody (7E6.)

Images

 
Western Blot: Neuronal Pentraxin 1 Antibody (7E6) [H00004884-M06] - Analysis of NPTX1 expression in transfected 293T cell line by NPTX1 monoclonal antibody (M06), clone 7E6. Lane 1: NPTX1 transfected lysate (Predicted ...read more
Sandwich ELISA: Neuronal Pentraxin 1 Antibody (7E6) [H00004884-M06] - Detection limit for recombinant GST tagged NPTX1 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
7E6.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Neuronal Pentraxin 1 Antibody (7E6.) Summary

Immunogen
NPTX1 (NP_002513.2 141 a.a. - 240 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KTRLENLEQYSRLNSSSQTNSLKDLLQSKIDELERQVLSRVNTLEEGKGGPRNDTEERVKIETALTSLHQRISELEKGQKDNRPGDKFQLTFPLRTNYMY
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NPTX1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Neuronal Pentraxin 1 Antibody (7E6.)

  • DKFZp686J2446
  • MGC105123
  • Neuronal Pentraxin 1
  • neuronal pentraxin INP1NP-I
  • neuronal pentraxin-1
  • NP1
  • NPTX1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF567
Species: Mu, Rt
Applications: WB, Simple Western, IHC, Block
NBP1-76899
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF566
Species: Mu, Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
7707-NP
Species: Hu
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59448
Species: Hu
Applications: WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
AF4414
Species: Hu
Applications: WB, IHC
NBP1-25966
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-52131
Species: Hu
Applications: IHC, PEP-ELISA
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NB100-2218
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-52131
Species: Hu
Applications: IHC, PEP-ELISA

Publications for Neuronal Pentraxin 1 Antibody (H00004884-M06) (0)

There are no publications for Neuronal Pentraxin 1 Antibody (H00004884-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neuronal Pentraxin 1 Antibody (H00004884-M06) (0)

There are no reviews for Neuronal Pentraxin 1 Antibody (H00004884-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Neuronal Pentraxin 1 Antibody (H00004884-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Neuronal Pentraxin 1 Products

Bioinformatics Tool for Neuronal Pentraxin 1 Antibody (H00004884-M06)

Discover related pathways, diseases and genes to Neuronal Pentraxin 1 Antibody (H00004884-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neuronal Pentraxin 1 Antibody (H00004884-M06)

Discover more about diseases related to Neuronal Pentraxin 1 Antibody (H00004884-M06).
 

Pathways for Neuronal Pentraxin 1 Antibody (H00004884-M06)

View related products by pathway.

PTMs for Neuronal Pentraxin 1 Antibody (H00004884-M06)

Learn more about PTMs related to Neuronal Pentraxin 1 Antibody (H00004884-M06).

Blogs on Neuronal Pentraxin 1

There are no specific blogs for Neuronal Pentraxin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Neuronal Pentraxin 1 Antibody (7E6.) and receive a gift card or discount.

Bioinformatics

Gene Symbol NPTX1
Entrez
Uniprot