Neurokinin B Antibody - BSA Free

Western Blot: Neurokinin B Antibody [NBP2-85377] - WB Suggested Anti-TAC3 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: Human brain

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Neurokinin B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Neurokinin B Antibody - BSA Free (NBP2-85377) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human Neurokinin B. Peptide sequence: RSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDF The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TAC3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Neurokinin B Antibody - BSA Free

• gamma tachykinin 3
• neurokinin beta
• neurokinin B-like
• neuromedin K
• preprotachykinin B
• PRO1155
• tachykinin 3
• tachykinin-3
• ZNEUROK1NKNBNKB

Background

The Neurokinins, also known as Tachykinins, belong to an evolutionary conserved family of peptide neurotransmitters that share a c-terminal sequence and have an established role in neurotransmission. The mammalian tachykinins include substance P (NK1), neurokinin A (NKA) and neurokinin B (NKB) which exert their effects by binding to specific receptors. Tachykinin peptides are important in the mediation of many physiological and pathological processes including inflammation, pain, migraine headache and allergy induced asthma.

Three tachykinin receptor types have been characterized, NK-1, NK-2 and NK-3 which have preferential affinities for SP, NKA and NKB respectively. All three receptors share a high degree of sequence homology, have seven transmembrane spanning domains and similar signal transduction mechanisms (e.g. G-protein coupled activation of phospholipase C).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TAC3