Neudesin Antibody


Immunocytochemistry/ Immunofluorescence: Neudesin Antibody [NBP2-13652] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
Immunohistochemistry: Neudesin Antibody [NBP2-13652] - Staining of human lateral ventricle shows moderate cytoplasmic positivity in neurons.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

Neudesin Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LDPADLTHDTTGLTAKELEALDEVFTKVYKAKYPIVGYTARRILNEDGSP NLDFKPEDQP
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (92%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Neudesin Protein (NBP2-13652PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Neudesin Antibody

  • Cell immortalization-related protein 2
  • CIR2
  • CIR2cell growth-inhibiting protein 47
  • NENF
  • Neudesin
  • neuron derived neurotrophic factor
  • Neuron-derived neurotrophic factor
  • SCIRP10
  • SCIRP10-related protein
  • Secreted protein of unknown function
  • Spinal cord injury related protein 10
  • SPUF protein
  • SPUF
  • SPUFneudesin


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IP, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Species: Hu
Applications: WB
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Neudesin Antibody (NBP2-13652) (0)

There are no publications for Neudesin Antibody (NBP2-13652).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neudesin Antibody (NBP2-13652) (0)

There are no reviews for Neudesin Antibody (NBP2-13652). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Neudesin Antibody (NBP2-13652) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Neudesin Products

Bioinformatics Tool for Neudesin Antibody (NBP2-13652)

Discover related pathways, diseases and genes to Neudesin Antibody (NBP2-13652). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neudesin Antibody (NBP2-13652)

Discover more about diseases related to Neudesin Antibody (NBP2-13652).

Pathways for Neudesin Antibody (NBP2-13652)

View related products by pathway.

Blogs on Neudesin

There are no specific blogs for Neudesin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Neudesin Antibody and receive a gift card or discount.


Gene Symbol NENF