Neudesin Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Neudesin Antibody [NBP2-13652] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.

Immunohistochemistry: Neudesin Antibody [NBP2-13652] - Staining of human lateral ventricle shows moderate cytoplasmic positivity in neurons.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Neudesin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Neudesin Antibody - BSA Free (NBP2-13652) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: LDPADLTHDTTGLTAKELEALDEVFTKVYKAKYPIVGYTARRILNEDGSPNLDFKPEDQP
• Predicted Species: Mouse (97%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NENF
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Neudesin Protein (NBP2-13652PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Neudesin Antibody - BSA Free

• Cell immortalization-related protein 2
• CIR2
• CIR2cell growth-inhibiting protein 47
• NENF
• Neudesin
• neuron derived neurotrophic factor
• Neuron-derived neurotrophic factor
• SCIRP10
• SCIRP10-related protein
• Secreted protein of unknown function
• Spinal cord injury related protein 10
• SPUF protein
• SPUF
• SPUFneudesin

Background

The NENF gene encodes a neurotrophic factor that may play a role in neuron differentiation and development. A pseudogene of this gene is found on chromosome 12. Alternate splicing of this gene results in multiple transcript variants. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NENF