Recombinant Human NEU3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NEU3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 411-520 of Human NEU3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VTWHHGRLIRPMVTVECEVAEVTGRAGHPVLYCSARTPNRCRAEALSTDHGEGFQRLALSRQLCEPPHGCQGSVVSFRPLEIPHRCQDSSSKDAPTIQQSSPGSSLRLEE

Protein/Peptide Type
Partial Recombinant Protein
Gene
NEU3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NEU3 Protein

  • EC 3.2.1.18
  • FLJ12388
  • Ganglioside sialidase
  • Membrane sialidase
  • N-acetyl-alpha-neuraminidase 3
  • neuraminidase 3
  • SIAL3
  • sialidase 3 (membrane sialidase)
  • sialidase-3

Background

This gene product belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. It is localized in the plasma membrane, and its activity is specific for gangliosides. It may play a role in modulating the ganglioside content of the lipid bilayer. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6860
Species: Hu
Applications: WB, IP
AF3638
Species: Hu
Applications: WB
NBP2-30039
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-32682
Species: Hu
Applications: WB, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-12071
Species: Mu
Applications: WB, IHC, IHC-Fr
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP1-92177
Species: Hu
Applications: IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC

Publications for NEU3 Partial Recombinant Protein (H00010825-Q01) (0)

There are no publications for NEU3 Partial Recombinant Protein (H00010825-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NEU3 Partial Recombinant Protein (H00010825-Q01) (0)

There are no reviews for NEU3 Partial Recombinant Protein (H00010825-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NEU3 Partial Recombinant Protein (H00010825-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NEU3 Products

Bioinformatics Tool for NEU3 Partial Recombinant Protein (H00010825-Q01)

Discover related pathways, diseases and genes to NEU3 Partial Recombinant Protein (H00010825-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NEU3 Partial Recombinant Protein (H00010825-Q01)

Discover more about diseases related to NEU3 Partial Recombinant Protein (H00010825-Q01).
 

Pathways for NEU3 Partial Recombinant Protein (H00010825-Q01)

View related products by pathway.

PTMs for NEU3 Partial Recombinant Protein (H00010825-Q01)

Learn more about PTMs related to NEU3 Partial Recombinant Protein (H00010825-Q01).

Blogs on NEU3

There are no specific blogs for NEU3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NEU3 Antibody
NBP2-48694

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NEU3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NEU3