NETO1 Antibody


Western Blot: NETO1 Antibody [NBP1-69039] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: 721_B cell lysate
Immunohistochemistry-Paraffin: NETO1 Antibody [NBP1-69039] - Mice retinal neurons tissue.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

NETO1 Antibody Summary

Synthetic peptides corresponding to NETO1 (neuropilin (NRP) and tolloid (TLL)-like 1) The peptide sequence was selected from the C terminal of NETO1. Peptide sequence MCINNTLVCNGLQNCVYPWDENHCKEKRKTSLLDQLTNTSGTVIGVTSCI.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Theoretical MW
58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NETO1 Antibody

  • BCTL1
  • Brain-specific transmembrane protein containing 2 CUB and 1 LDL-receptor classA domains protein 1
  • BTCL1
  • BTCL1BCTL1neuropilin and tolloid-like protein 1
  • FLJ41325
  • NETO1
  • neuropilin (NRP) and tolloid (TLL)-like 1


This gene encodes a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. A similar gene in mice encodes a protein that plays a critical role in spatial learning and memory by regulating the function of synaptic N-methyl-D-aspartic acid receptor complexes in the hippocampus. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: ICC/IF
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for NETO1 Antibody (NBP1-69039) (0)

There are no publications for NETO1 Antibody (NBP1-69039).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NETO1 Antibody (NBP1-69039) (0)

There are no reviews for NETO1 Antibody (NBP1-69039). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NETO1 Antibody (NBP1-69039) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NETO1 Products

Bioinformatics Tool for NETO1 Antibody (NBP1-69039)

Discover related pathways, diseases and genes to NETO1 Antibody (NBP1-69039). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NETO1 Antibody (NBP1-69039)

Discover more about diseases related to NETO1 Antibody (NBP1-69039).

Pathways for NETO1 Antibody (NBP1-69039)

View related products by pathway.

Research Areas for NETO1 Antibody (NBP1-69039)

Find related products by research area.

Blogs on NETO1

There are no specific blogs for NETO1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NETO1 Antibody and receive a gift card or discount.


Gene Symbol NETO1