NETO2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: NETO2 Antibody [NBP1-84624] - Staining of human cell line SiHa shows localization to the Golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: NETO2 Antibody [NBP1-84624] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myoctes.

Immunohistochemistry-Paraffin: NETO2 Antibody [NBP1-84624] - Staining of human testis shows moderate granular cytoplasm positivity in leydig cells and cells in seminiferous ducts.

Immunohistochemistry-Paraffin: NETO2 Antibody [NBP1-84624] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: NETO2 Antibody [NBP1-84624] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NETO2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SYPPNKECIYILEAAPRQRIELTFDEHYYIEPSFECRFDHLEVRDGPFGFSPLIDRYCGVKSPPLIRSTGRFMWIKFSSDEELEGLGFRAKYSFIPDPDFTYLGGILNPIPDCQFELSGADGIVRSSQVEQEEKTKPGQAVDCIWTIKA
• Predicted Species: Mouse (97%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NETO2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NETO2 Protein (NBP1-84624PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NETO2 Antibody - BSA Free

• Brain-specific transmembrane protein containing 2 CUB and 1 LDL-receptor classA domains protein 2
• BTCL2
• FLJ10430
• FLJ90456
• NEOT2
• NEOT2FLJ14724
• NETO2
• neuropilin (NRP) and tolloid (TLL)-like 2
• neuropilin and tolloid-like protein 2

Background

NETO2 encodes a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. It also has an intracellular FXNPXY-like motif, which has been shown in other proteins to be essential for the internalization of clathrin coated pits during endocytosis. Alternatively spliced transcript variants have been observed, but they have not been fully characterized. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NETO2 Antibody (NBP1-84624)(2)

Publications using NBP1-84624

• Zhai J, Xu Y, Wan H et al. Neurulation of the cynomolgus monkey embryo achieved from 3D blastocyst culture Cell 2023-05-11 [PMID: 37172562] (Immunohistochemistry, Primate - Macaca fascicularis (Crab-eating Monkey or Cynomolgus Macaque))
• Copits BA, Robbins JS, Frausto S et al. Synaptic targeting and functional modulation of GluK1 kainate receptors by the auxiliary neuropilin and tolloid-like (NETO) proteins. J Neurosci 2011-05-01 [PMID: 21593317]

Bioinformatics

• Gene Symbol: NETO2