NEI3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NEI3 Antibody [NBP2-56282] - Staining of human cell line A549 shows localization to nucleoplasm. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NEI3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EALFDSGLHPAVKVCQLTDEQIHHLMKMIRDFSILFYRCRKAGLALSKHYKVYKRPNCGQCHCRITVC
Specificity
Specificity of human NEI3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NEIL3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NEI3 Recombinant Protein Antigen (NBP2-56282PEP)

Reactivity Notes

Mouse 81%, Rat 84%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for NEI3 Antibody

  • DNA glycosylase FPG2
  • DNA glycosylase hFPG2
  • DNA glycosylase/AP lyase Neil3
  • EC 3.2.2.-
  • EC 4.2.99.18
  • endonuclease 8-like 3
  • Endonuclease VIII-like 3
  • FGP2
  • FLJ10858
  • FPG2
  • hFPG2
  • hNEI3
  • nei endonuclease VIII-like 3 (E. coli)
  • NEI3
  • Nei-like protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-47358
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-106
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
H00252969-M01
Species: Hu
Applications: WB, ELISA, RNAi, S-ELISA
NB100-108
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, ChIP, KD
MAB4077
Species: Hu
Applications: WB, IHC
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
H00003660-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB6967
Species: Hu
Applications: WB
NB100-74611
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00055589-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi, S-ELISA
NBP2-94064
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-58200
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NB100-109
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IB, ICC/IF, IHC, IHC-Fr, IHC-P, KO, Single-Cell Western
NB600-233
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
NBP2-56282
Species: Hu
Applications: ICC/IF

Publications for NEI3 Antibody (NBP2-56282) (0)

There are no publications for NEI3 Antibody (NBP2-56282).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NEI3 Antibody (NBP2-56282) (0)

There are no reviews for NEI3 Antibody (NBP2-56282). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NEI3 Antibody (NBP2-56282) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NEI3 Products

Bioinformatics Tool for NEI3 Antibody (NBP2-56282)

Discover related pathways, diseases and genes to NEI3 Antibody (NBP2-56282). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NEI3 Antibody (NBP2-56282)

Discover more about diseases related to NEI3 Antibody (NBP2-56282).
 

Pathways for NEI3 Antibody (NBP2-56282)

View related products by pathway.

PTMs for NEI3 Antibody (NBP2-56282)

Learn more about PTMs related to NEI3 Antibody (NBP2-56282).
 

Research Areas for NEI3 Antibody (NBP2-56282)

Find related products by research area.

Blogs on NEI3

There are no specific blogs for NEI3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NEI3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NEIL3