NEDD4L Antibody - BSA Free

Western Blot: NEDD4L Antibody [NBP1-54974] - Titration: 0.2-1 ug/ml, Positive Control: PANC1 cell lysate.

Western Blot: NEDD4L Antibody [NBP1-54974] - Human cystic fibrosis epithelial.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NEDD4L Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to NEDD4L(neural precursor cell expressed, developmentally down-regulated 4-like) The peptide sequence was selected from the middle region of NEDD4L. Peptide sequence TVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPKPQHKVTQSFLP The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NEDD4L
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 110 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NEDD4L Antibody - BSA Free

• E3 ubiquitin-protein ligase NEDD4-like
• EC 6.3.2
• EC 6.3.2.-
• FLJ33870
• hNedd4-2
• KIAA0439ubiquitin-protein ligase NEDD4-like
• NEDD4.2
• NEDD4-2
• NEDL3
• neural precursor cell expressed, developmentally down-regulated 4-like
• neural precursor cell expressed, developmentally down-regulated gene 4-like
• RSP5ubiquitin-protein ligase Rsp5

Background

NEDD4L is an E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. NEDD4L inhibits TGF-beta signaling by triggering SMAD2 and TGFR1 ubiquitination and proteasome-dependent degradation. NEDD4L promotes ubiquitination and internalization of various plasma membrane channels such as ENaC, Nav1.2, Nav1.3, Nav1.5, Nav1.7, Nav1.8, Kv1.3, EAAT1 or CLC5. NEDD4L also promotes ubiquitination and degradation of SGK.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NEDD4L
• Uniprot:
  • Q96PU5-5(Human)